TkAUNG097860 | RubberDandelionOmics

Gene overview

TkAUNG097860

Reference: TK1151 Chr: ChrUn Coordinates: 27638281-27643735 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2786 bp · TkAUNG097860|TK1151|cDNA

TTTTGATATAGATATGTAGATAAACCGAGAGAGAGAGAGAGAGAGAGACTTCTCACCTGTTTGTTAAGCTGCTTGTCGTTATTGATGACACCTACCCTTCGTGTCTATTCTAATTCTAGTGACCATCGGCCTGCAACTTTTGTTTCTACTTCGGAATATTTCTTTCTCTAATGGCGTCTTCTTCTTCTCCTCCTCCTCCTACTACTACCACTTGTACATACCTGATCACACGCACTTCTCCCAAGGTCCAACTCAATGGC...

CDS

Download CDS FASTA

1377 bp · TkAUNG097860|TK1151|CDS

ATGGCTTCCGCCATCACTGCTTACATCGCCGTGGTACTGACAACCGTCGTCCTTCTCTTTACCGTTACTCACTCATCGACTCTTGGAGTTGAATATCTGTCGCGTCTTCTCGAAGTTCAGGATCGAGAGAGAGCACCGTCGTCTGTACAAATTTCCGCTGCTAAAGCGGTGCTTGATCGCCTCATTCCTTCCCATTCAGCTAGTTTCGACTTTCAGATCATCACCAAGGAGCATTGTGGTGGAGTTTCCTGCTTTTCAAT...

Protein

Download Protein FASTA

458 aa · TkAUNG097860|TK1151|PROTEIN

MASAITAYIAVVLTTVVLLFTVTHSSTLGVEYLSRLLEVQDRERAPSSVQISAAKAVLDRLIPSHSASFDFQIITKEHCGGVSCFSISNHPSSNVQGAPEILVRGVTGVELLAGLHWYLKNLCGAHISWDKTGGSQLSSVPKSGFLPKIQDDGLLIQRPVPWNYYQNAVTSSYTFAWWDWKRWEKEIDWMALQGINMPLAFTGQEAIWQKVFEQKFNISSSDLDDFFGGPAFLAWSRMANLHGWGGPLPQSWLDQQLAMQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG097860`
TK1151 ID	TkAUNG097860
OH-1004 ID	LXL04_009593
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 95.852 / OH-1004 54.682 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG097860

Location ChrUn:27638281-27643735 (-)

Description Similar to NAGLU: Alpha-N-acetylglucosaminidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13690`	Involved in the remodeling of the N-acetyl-glucosamine residues of proteoglycan complexes during reproductive development.	The alpha-N-acetyl-glucosaminidase gene is transcriptionally activated in male and female gametes prior to fertilization and is essential for seed development in Arabidopsis.2008 · DOI: 10.1093/jxb/ern215

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009593 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030200 heparan sulfate proteoglycan catabolic process Biological Process

GO:0030202 heparin proteoglycan metabolic process Biological Process

GO:0048316 seed development Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0043202 lysosomal lumen Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0004561 alpha-N-acetylglucosaminidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G13690

hsa:4669

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.493

Rank 1 · TkAUNG097860 · TK1151

Extracellular0.197

Rank 2 · TkAUNG097860 · TK1151

Cytoplasm0.122

Rank 3 · TkAUNG097860 · TK1151

Endoplasmic reticulum0.110

Rank 4 · TkAUNG097860 · TK1151

Cell membrane0.093

Rank 5 · TkAUNG097860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12971NAGLU_N53-147 aa

PF05089NAGLU164-439 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG097860	`PF12971`	NAGLU_N	53	147	7.4e-23	81.0
TkAUNG097860	`PF05089`	NAGLU	164	439	2.9e-116	388.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNA3`	Arabidopsis thaliana	sp\|Q9FNA3\|NAGLU_ARATH Alpha-N-acetylglucosaminidase	64.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card