LXL04_009593 | RubberDandelionOmics

Gene overview

LXL04_009593

Reference: OH-1004 Chr: Chr02 Coordinates: 129364777-129369657 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2406 bp · LXL04_009593|LXL04_009593|OH1004|cDNA

ATGGCTTCCGCCATCACTGCTTACATCGCCGTGGTACTGACAACCGTCGTCCTTCTCTTTACCGTTACTCACTCATCGACTCTTGGAGTTGAATATCTGTCGCGTCTTCTCGAAGTTCAGGATCGAGAGAGAGCACCGTCGTCTGTACAAATTTCCGCTGCTAAAGCGGTGCTTGATCGCCTCATTCCTTCCCATTCAGCTAGTTTCGACTTTCAGATCATCACCAAGGAGCATTGTGGTGGAGTTTCCTGCTTTTCAAT...

CDS

Download CDS FASTA

2406 bp · LXL04_009593|LXL04_009593|OH1004|CDS

ATGGCTTCCGCCATCACTGCTTACATCGCCGTGGTACTGACAACCGTCGTCCTTCTCTTTACCGTTACTCACTCATCGACTCTTGGAGTTGAATATCTGTCGCGTCTTCTCGAAGTTCAGGATCGAGAGAGAGCACCGTCGTCTGTACAAATTTCCGCTGCTAAAGCGGTGCTTGATCGCCTCATTCCTTCCCATTCAGCTAGTTTCGACTTTCAGATCATCACCAAGGAGCATTGTGGTGGAGTTTCCTGCTTTTCAAT...

Protein

Download Protein FASTA

801 aa · LXL04_009593|LXL04_009593|OH1004|PROTEIN

MASAITAYIAVVLTTVVLLFTVTHSSTLGVEYLSRLLEVQDRERAPSSVQISAAKAVLDRLIPSHSASFDFQIITKEHCGGVSCFSISNHPSSNVQGAPEILIRGVTGVELLAGLHWYLKNLCGAHISWDKTGGSQLSSVPKSGFLPKIQDDGLLIQRPVPWNYYQNAVTSSYTFAWWDWKRWEKEIDWMALQGINMPLAFTGQEAIWQKVFEKFNISSSDLDDFFGGPAFLAWSRMANLHGWGGPLPQSWLDQQLAMQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009593`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009593

Location Chr02:129364777-129369657 (+)

Description Similar to NAGLU: Alpha-N-acetylglucosaminidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13690`	Involved in the remodeling of the N-acetyl-glucosamine residues of proteoglycan complexes during reproductive development.	The alpha-N-acetyl-glucosaminidase gene is transcriptionally activated in male and female gametes prior to fertilization and is essential for seed development in Arabidopsis.2008 · DOI: 10.1093/jxb/ern215

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009593 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0030200 heparan sulfate proteoglycan catabolic process Biological Process

GO:0030202 heparin proteoglycan metabolic process Biological Process

GO:0048316 seed development Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0043202 lysosomal lumen Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0004561 alpha-N-acetylglucosaminidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G13690

hsa:4669

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.446

Rank 1 · LXL04_009593 · OH-1004

Extracellular0.193

Rank 2 · LXL04_009593 · OH-1004

Cell membrane0.119

Rank 3 · LXL04_009593 · OH-1004

Cytoplasm0.115

Rank 4 · LXL04_009593 · OH-1004

Endoplasmic reticulum0.110

Rank 5 · LXL04_009593 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12971.13NAGLU_N53-147 aa

PF05089.19NAGLU164-499 aa

PF12972.13NAGLU_C508-790 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009593	`PF12971.13`	NAGLU_N	53	147	5.7e-23	81.4
LXL04_009593	`PF05089.19`	NAGLU	164	499	2.9e-145	484.2
LXL04_009593	`PF12972.13`	NAGLU_C	508	790	4e-88	296.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNA3`	Arabidopsis thaliana	Alpha-N-acetylglucosaminidase	60.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card