TkAUNG096710 | RubberDandelionOmics

Gene overview

TkAUNG096710

Reference: TK1151 Chr: ChrUn Coordinates: 27337670-27338452 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · TkAUNG096710|TK1151|cDNA

AGAGGTAAAAACGTTTGTGGGCGAGAAGACGTGGTTCAAACTCGAAATCGGCCGGTATTACCTCCGATCGCAGCTAAGCTAGACGTCGCCGGCCCCGAAATCGCCGGCATTAACTCCGTTCGCGACTTTCTAGACCACCGCGCTGTTCTCGACCACCGGACCACCTACAATCGCACCTGTTCAGTCCCACCTGTTCAGCCTCCTTCCTGCTCGACGCCTCCATCCTGTTTAGCGCGTCCATCCTGTTCAGCACCAGCTCT...

CDS

Download CDS FASTA

384 bp · TkAUNG096710|TK1151|CDS

AGAGGTAAAAACGTTTGTGGGCGAGAAGACGTGGTTCAAACTCGAAATCGGCCGGTATTACCTCCGATCGCAGCTAAGCTAGACGTCGCCGGCCCCGAAATCGCCGGCATTAACTCCGTTCGCGACTTTCTAGACCACCGCGCTGTTCTCGACCACCGGACCACCTACAATCGCACCTGTTCAGTCCCACCTGTTCAGCCTCCTTCCTGCTCGACGCCTCCATCCTGTTTAGCGCGTCCATCCTGTTCAGCACCAGCTCT...

Protein

Download Protein FASTA

127 aa · TkAUNG096710|TK1151|PROTEIN

RGKNVCGREDVVQTRNRPVLPPIAAKLDVAGPEIAGINSVRDFLDHRAVLDHRTTYNRTCSVPPVQPPSCSTPPSCLARPSCSAPALSCSAPPSSFLLFDSVKRLMFKGELHYLAMLALDVMLQGET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG096710`
TK1151 ID	TkAUNG096710
OH-1004 ID	LXL04_005690
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.900
Protein coverage (%)	TK1151 38.583 / OH-1004 28.916 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG096710`
Location	ChrUn:27337670-27338452 (+)
Description	Similar to CCT1: T-complex protein 1 subunit alpha
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005690` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0007021 tubulin complex assembly Biological Process GO:0032212 positive regulation of telomere maintenance via telomerase Biological Process GO:0050821 protein stabilization Biological Process GO:0090666 scaRNA localization to Cajal body Biological Process GO:1904851 positive regulation of establishment of protein localization to telomere Biological Process GO:1904871 positive regulation of protein localization to Cajal body Biological Process GO:1904874 positive regulation of telomerase RNA localization to Cajal body Biological Process GO:0000242 pericentriolar material Cellular Component GO:0000792 heterochromatin Cellular Component GO:0001669 acrosomal vesicle Cellular Component GO:0002199 zona pellucida receptor complex Cellular Component
KEGG gene cross-reference	ath:AT3G20050 cge:100689476 hsa:6950 mdo:497250 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.393

Rank 1 · TkAUNG096710 · TK1151

Nucleus0.392

Rank 2 · TkAUNG096710 · TK1151

Cell membrane0.137

Rank 3 · TkAUNG096710 · TK1151

Mitochondrion0.129

Rank 4 · TkAUNG096710 · TK1151

Endoplasmic reticulum0.096

Rank 5 · TkAUNG096710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14723SSFA2_C59-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG096710	`PF14723`	SSFA2_C	59	96	0.75	10.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card