LXL04_005690 | RubberDandelionOmics

Gene overview

LXL04_005690

Reference: OH-1004 Chr: Chr01 Coordinates: 170939034-170942849 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

506 bp · LXL04_005690|LXL04_005690|OH1004|cDNA

CATTtatgtctgcgggcgggaagaggTTTTGGTCTGCAGAGTTGAAAAGAGCGTTTGTTTTTTGGAAGACAAAAGAGGTTTGCAGAGGTAAAAacgtctgcgggcgggaagacgtGCAAACTCGAAATCGGCCGGTGTTACCTTCGATCGCAGCTAAGCTAGACGTCGCTGGCCCCGAAATCGCCGGCATTAACTCCGTTCGCGACTTTCTAGACCACCGCGTTGTTCTCGACCACCGGACCACCTACAATCGCACCTGT...

CDS

Download CDS FASTA

501 bp · LXL04_005690|LXL04_005690|OH1004|CDS

ATGTCTGCGGGCGGGAAGAGGTTTTGGTCTGCAGAGTTGAAAAGAGCGTTTGTTTTTTGGAAGACAAAAGAGGTTTGCAGAGGTAAAAACGTCTGCGGGCGGGAAGACGTGCAAACTCGAAATCGGCCGGTGTTACCTTCGATCGCAGCTAAGCTAGACGTCGCTGGCCCCGAAATCGCCGGCATTAACTCCGTTCGCGACTTTCTAGACCACCGCGTTGTTCTCGACCACCGGACCACCTACAATCGCACCTGTTCAGC...

Protein

Download Protein FASTA

166 aa · LXL04_005690|LXL04_005690|OH1004|PROTEIN

MSAGGKRFWSAELKRAFVFWKTKEVCRGKNVCGREDVQTRNRPVLPSIAAKLDVAGPEIAGINSVRDFLDHRVVLDHRTTYNRTCSASFLLDTSILFSASIMFSISILFNASFILPPISQLSLILRGANDFMLDEMDTGLHDADCIVKRTIQSNTVVAGGGAIEAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005690`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005690

Location Chr01:170939034-170942849 (-)

Description Similar to CCT1: T-complex protein 1 subunit alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20050`	Molecular chaperone; assists the folding of proteins upon ATP hydrolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005690 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0007021 tubulin complex assembly Biological Process

GO:0032212 positive regulation of telomere maintenance via telomerase Biological Process

GO:0050821 protein stabilization Biological Process

GO:0090666 scaRNA localization to Cajal body Biological Process

GO:1904851 positive regulation of establishment of protein localization to telomere Biological Process

GO:1904871 positive regulation of protein localization to Cajal body Biological Process

GO:1904874 positive regulation of telomerase RNA localization to Cajal body Biological Process

GO:0000242 pericentriolar material Cellular Component

GO:0000792 heterochromatin Cellular Component

GO:0001669 acrosomal vesicle Cellular Component

GO:0002199 zona pellucida receptor complex Cellular Component

KEGG gene cross-reference

ath:AT3G20050

cge:100689476

hsa:6950

mdo:497250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.379

Rank 1 · LXL04_005690 · OH-1004

Nucleus0.339

Rank 2 · LXL04_005690 · OH-1004

Mitochondrion0.156

Rank 3 · LXL04_005690 · OH-1004

Extracellular0.074

Rank 4 · LXL04_005690 · OH-1004

Cell membrane0.062

Rank 5 · LXL04_005690 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00118.30Cpn60_TCP1121-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005690	`PF00118.30`	Cpn60_TCP1	121	165	7.5e-10	38.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P28769`	Arabidopsis thaliana	T-complex protein 1 subunit alpha	76.596%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card