TkAUNG096650 | RubberDandelionOmics

Gene overview

TkAUNG096650

Reference: TK1151 Chr: ChrUn Coordinates: 27317956-27318846 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

705 bp · TkAUNG096650|TK1151|cDNA

AGCGGTATCGGACGTGGCCGAGTTTACCGCTGGCGATGGAGTCGGAACGGTGAAGCCAGCGGCAAACTCCAACGGCTCGGGCACACCGGTGGCCATCATTCTGCATTCTATAACATGAGGAGATACAACAAAAATACTTCATCAAATCGTAGAGGGTCTAACTCTTCTTCGCAACAAAACGAAGATAGCCCTCCGCAACAAGAGGGATACCGCCCAACATTCGATCCTATGCTACATCAACAACAGCTGGCGTTTCAAGC...

CDS

Download CDS FASTA

705 bp · TkAUNG096650|TK1151|CDS

AGCGGTATCGGACGTGGCCGAGTTTACCGCTGGCGATGGAGTCGGAACGGTGAAGCCAGCGGCAAACTCCAACGGCTCGGGCACACCGGTGGCCATCATTCTGCATTCTATAACATGAGGAGATACAACAAAAATACTTCATCAAATCGTAGAGGGTCTAACTCTTCTTCGCAACAAAACGAAGATAGCCCTCCGCAACAAGAGGGATACCGCCCAACATTCGATCCTATGCTACATCAACAACAGCTGGCGTTTCAAGC...

Protein

Download Protein FASTA

234 aa · TkAUNG096650|TK1151|PROTEIN

SGIGRGRVYRWRWSRNGEASGKLQRLGHTGGHHSAFYNMRRYNKNTSSNRRGSNSSSQQNEDSPPQQEGYRPTFDPMLHQQQLAFQAWCQTQPQYQYQYQQPQYPTPQYPTPQYQYQSPQFQTPLPQFQTPSPQFQTSSPLSHTSSPQFESQSPFTEESTQEVPETQEEASDSEESEEEEVGRGKGKTVRKNWTNREEEVLAEAWCGHSGDARYGNDQNANSFGNMLPSVSTRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG096650`
TK1151 ID	TkAUNG096650
OH-1004 ID	LXL04_035197
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.800
Protein coverage (%)	TK1151 88.034 / OH-1004 17.998 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG096650`
Location	ChrUn:27317956-27318846 (-)
Description	Similar to MSP1: Protein MSP1 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035197` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000281 mitotic cytokinesis Biological Process GO:0001578 microtubule bundle formation Biological Process GO:0002092 positive regulation of receptor internalization Biological Process GO:0006626 protein targeting to mitochondrion Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0009653 anatomical structure morphogenesis Biological Process GO:0010458 exit from mitosis Biological Process GO:0031117 positive regulation of microtubule depolymerization Biological Process GO:0031468 nuclear membrane reassembly Biological Process GO:0032506 cytokinetic process Biological Process GO:0034214 protein hexamerization Biological Process GO:0045047 protein targeting to ER Biological Process
KEGG gene cross-reference	mmu:67979 rno:309532 sce:YGR028W xla:446560 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · TkAUNG096650 · TK1151

Cytoplasm0.180

Rank 2 · TkAUNG096650 · TK1151

Mitochondrion0.016

Rank 3 · TkAUNG096650 · TK1151

Cell membrane0.015

Rank 4 · TkAUNG096650 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkAUNG096650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15087DUF455131-178 aa

PF03153TFIIA53-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG096650	`PF15087`	DUF4551	31	178	2.3	7.8
TkAUNG096650	`PF03153`	TFIIA	53	181	2.6	8.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card