TkAUNG096030 | RubberDandelionOmics

Gene overview

TkAUNG096030

Reference: TK1151 Chr: ChrUn Coordinates: 27157468-27158682 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

686 bp · TkAUNG096030|TK1151|cDNA

ATGCGTGTGTCAGTGTGTTGTGTGTTCAAATGTTCTTATATGTAGGAGCCTCACTTAGTCTTTGCATAATAGACACATACACACACACAAAGTGTTGCGGTGGTGATCGTGGGTGGCAGATGGCGGAGTTCACACATTTGGTGGTGGTGAAGTTCAAGGAAGAGGTGGTGGTGGAAGATATCATCAAAGGGTTGGAGGACCTTGTTTCTCAAGTTGATAGTGTCAAGTCCTTTGTTTGGGGAAAGGATATTGAGAGTATG...

CDS

Download CDS FASTA

408 bp · TkAUNG096030|TK1151|CDS

ATGTTCTTATATGTAGGAGCCTCACTTAGTCTTTGCATAATAGACACATACACACACACAAAGTGTTGCGGTGGTGATCGTGGGTGGCAGATGGCGGAGTTCACACATTTGGTGGTGGTGAAGTTCAAGGAAGAGGTGGTGGTGGAAGATATCATCAAAGGGTTGGAGGACCTTGTTTCTCAAGTTGATAGTGTCAAGTCCTTTGTTTGGGGAAAGGATATTGAGAGTATGGAGATGCTAAGGCAAGGATTCACACATGC...

Protein

Download Protein FASTA

135 aa · TkAUNG096030|TK1151|PROTEIN

MFLYVGASLSLCIIDTYTHTKCCGGDRGWQMAEFTHLVVVKFKEEVVVEDIIKGLEDLVSQVDSVKSFVWGKDIESMEMLRQGFTHAFMMTFGSKDDFTAFQTHPNHMQFSATFSAAIDKIVLLDFPVVAFKPPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG096030`
TK1151 ID	TkAUNG096030
OH-1004 ID	LXL04_010407
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	40.600
Protein coverage (%)	TK1151 76.296 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG096030

Location ChrUn:27157468-27158682 (+)

Description Similar to HS1: Stress-response A/B barrel domain-containing protein HS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22580`	Involved in stress response.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010407 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009865 pollen tube adhesion Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1901696 cannabinoid biosynthetic process Biological Process

GO:1901697 olivetolic acid biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ag:AFN42527

ath:AT2G31670

ath:AT3G17210

ath:AT5G22580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.679

Rank 1 · TkAUNG096030 · TK1151

Nucleus0.268

Rank 2 · TkAUNG096030 · TK1151

Endoplasmic reticulum0.113

Rank 3 · TkAUNG096030 · TK1151

Peroxisome0.077

Rank 4 · TkAUNG096030 · TK1151

Mitochondrion0.063

Rank 5 · TkAUNG096030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21056ZSWIM1-3_RNaseH-like32-88 aa

PF07876Dabb35-127 aa

PF06780Erp_C40-72 aa

PF21056ZSWIM1-3_RNaseH-like90-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG096030	`PF21056`	ZSWIM1-3_RNaseH-like	32	88	0.042	14.5
TkAUNG096030	`PF07876`	Dabb	35	127	4.8e-22	79.2
TkAUNG096030	`PF06780`	Erp_C	40	72	0.24	12.2
TkAUNG096030	`PF21056`	ZSWIM1-3_RNaseH-like	90	128	0.042	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK81`	Arabidopsis thaliana	sp\|Q9FK81\|Y5258_ARATH Stress-response A/B barrel domain-containing protein At5g22580	68.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card