TkAUNG095380 | RubberDandelionOmics

Gene overview

TkAUNG095380

Reference: TK1151 Chr: ChrUn Coordinates: 26975567-26977967 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1769 bp · TkAUNG095380|TK1151|cDNA

CGGAGATGTATTGGAACTTTTTGATGGCGTTTTATAACATTTCTCCTTTGACTCTTTTTAACCACCAAAGCTCCAAAACCCTAAAACCCCTCCTACTGAGAAATTCTGTCAATGGCTTGTAATGGGACCGGATGCCAGTCGGGGGGTTGCTATAAAGACAACGCCGGGGATGAAGAGGAAAAATTGTCGACGGAGAAGAAGTTAAACGGTGACAATTGTGGCGATGGTAATCACACTCGCCACCAGACGCTGTGCTTTAA...

CDS

Download CDS FASTA

1386 bp · TkAUNG095380|TK1151|CDS

ATGGCTTGTAATGGGACCGGATGCCAGTCGGGGGGTTGCTATAAAGACAACGCCGGGGATGAAGAGGAAAAATTGTCGACGGAGAAGAAGTTAAACGGTGACAATTGTGGCGATGGTAATCACACTCGCCACCAGACGCTGTGCTTTAAATGTAAGGCATCCGAAGCCACAATCTTCACCGGCGGCGAAGGTGGCAGTCGATTCTGTGCTGATTGCTTCCGGAGCAACCTTTATGGAAAGTTTAAGCTTGCTGTTACTTC...

Protein

Download Protein FASTA

461 aa · TkAUNG095380|TK1151|PROTEIN

MACNGTGCQSGGCYKDNAGDEEEKLSTEKKLNGDNCGDGNHTRHQTLCFKCKASEATIFTGGEGGSRFCADCFRSNLYGKFKLAVTSHAMISPTDKVLVAFSGGTSSRVALQFVSEMQLKSQKNFDATAIRDRSLPVFGVGVAFIDESEIHPIITSTDFNQSIENIKEIVSNLSPPKKNLHLVPISNIYSTKTSDGKDKLKNLINTVNDATGKEDLVTHLRMLSLQKIAIENGYTKLVLGSCTSRIACHVLSATVKGQGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG095380`
TK1151 ID	TkAUNG095380
OH-1004 ID	LXL04_018444
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG095380

Location ChrUn:26975567-26977967 (-)

Description Similar to CTU2: Cytoplasmic tRNA 2-thiolation protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35910`	Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2ZM73`	Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln).	No verified direct reference in this release
`Os12g0588900`	Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018444 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002098 tRNA wobble uridine modification Biological Process

GO:0002143 tRNA wobble position uridine thiolation Biological Process

GO:0010311 lateral root formation Biological Process

GO:0032447 protein urmylation Biological Process

GO:0034227 tRNA thio-modification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0016779 nucleotidyltransferase activity Molecular Function

GO:0016783 sulfurtransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G35910

dosa:Os12g0588900

dre:445166

hsa:348180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.579

Rank 1 · TkAUNG095380 · TK1151

Nucleus0.404

Rank 2 · TkAUNG095380 · TK1151

Mitochondrion0.098

Rank 3 · TkAUNG095380 · TK1151

Cell membrane0.063

Rank 4 · TkAUNG095380 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkAUNG095380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10288CTU224-52 aa

PF29994NMD3_N35-81 aa

PF20097DUF648740-52 aa

PF24734DUF768548-73 aa

PF29994NMD3_N283-333 aa

PF10288CTU2311-399 aa

PF20097DUF6487381-394 aa

PF29994NMD3_N393-412 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG095380	`PF10288`	CTU2	24	52	0.00012	23.1
TkAUNG095380	`PF29994`	NMD3_N	35	81	0.85	10.7
TkAUNG095380	`PF20097`	DUF6487	40	52	2.1	9.6
TkAUNG095380	`PF24734`	DUF7685	48	73	0.01	16.4
TkAUNG095380	`PF29994`	NMD3_N	283	333	0.85	10.7
TkAUNG095380	`PF10288`	CTU2	311	399	0.00012	23.1
TkAUNG095380	`PF20097`	DUF6487	381	394	2.1	9.6
TkAUNG095380	`PF29994`	NMD3_N	393	412	0.85	10.7
TkAUNG095380	`PF20097`	DUF6487	400	415	2.1	9.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65628`	Arabidopsis thaliana	sp\|O65628\|CTU2_ARATH Cytoplasmic tRNA 2-thiolation protein 2	57.200%	Swiss-Prot	High
`A2ZM73`	Oryza sativa subsp. indica	sp\|A2ZM73\|CTU2_ORYSI Cytoplasmic tRNA 2-thiolation protein 2	47.900%	Swiss-Prot	Medium
`Q2QMW0`	Oryza sativa subsp. japonica	sp\|Q2QMW0\|CTU2_ORYSJ Cytoplasmic tRNA 2-thiolation protein 2	47.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card