LXL04_018444 | RubberDandelionOmics

Gene overview

LXL04_018444

Reference: OH-1004 Chr: Chr04 Coordinates: 13041174-13043192 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1386 bp · LXL04_018444|LXL04_018444|OH1004|cDNA

ATGGCTTGTAATGGGACCGGATGCCAGTCGGGGGGTTGCTATAAAGACAACGCCGGGGATGAAGAGGAAAAATTGTCGACGGAGAAGAAGTTAAACGGTGACAATTGTGGCGATGGTAATCACACTCGCCACCAGACGCTGTGCTTTAAATGTAAGGCATCCGAAGCCACAATCTTCACCGGCGGCGAAGGTGGCAGTCGATTCTGTGCTGATTGCTTCCGGAGCAACCTTTATGGAAAGTTTAAGCTTGCTGTTACTTC...

CDS

Download CDS FASTA

1386 bp · LXL04_018444|LXL04_018444|OH1004|CDS

ATGGCTTGTAATGGGACCGGATGCCAGTCGGGGGGTTGCTATAAAGACAACGCCGGGGATGAAGAGGAAAAATTGTCGACGGAGAAGAAGTTAAACGGTGACAATTGTGGCGATGGTAATCACACTCGCCACCAGACGCTGTGCTTTAAATGTAAGGCATCCGAAGCCACAATCTTCACCGGCGGCGAAGGTGGCAGTCGATTCTGTGCTGATTGCTTCCGGAGCAACCTTTATGGAAAGTTTAAGCTTGCTGTTACTTC...

Protein

Download Protein FASTA

461 aa · LXL04_018444|LXL04_018444|OH1004|PROTEIN

MACNGTGCQSGGCYKDNAGDEEEKLSTEKKLNGDNCGDGNHTRHQTLCFKCKASEATIFTGGEGGSRFCADCFRSNLYGKFKLAVTSHAMISPTDKVLVAFSGGTSSRVALQFVSEMQLKSQKNFDATAIRDRSLPVFGVGVAFIDESEIHPIITSTDFNQSIENIKEMVSNLSPPKKNLHLVPISNIYSTKTSDGKDKLKNLINTVNDATGKEDLVTHLRMLSLQKIAIENGYTKLVLGSCTSRIACHVLSATVKGQGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018444`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018444

Location Chr04:13041174-13043192 (+)

Description Similar to CTU2: Cytoplasmic tRNA 2-thiolation protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35910`	Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2ZM73`	Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln).	No verified direct reference in this release
`Os12g0588900`	Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018444 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002098 tRNA wobble uridine modification Biological Process

GO:0002143 tRNA wobble position uridine thiolation Biological Process

GO:0010311 lateral root formation Biological Process

GO:0032447 protein urmylation Biological Process

GO:0034227 tRNA thio-modification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0016779 nucleotidyltransferase activity Molecular Function

GO:0016783 sulfurtransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G35910

dosa:Os12g0588900

dre:445166

hsa:348180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.573

Rank 1 · LXL04_018444 · OH-1004

Nucleus0.406

Rank 2 · LXL04_018444 · OH-1004

Mitochondrion0.100

Rank 3 · LXL04_018444 · OH-1004

Cell membrane0.063

Rank 4 · LXL04_018444 · OH-1004

Endoplasmic reticulum0.042

Rank 5 · LXL04_018444 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65628`	Arabidopsis thaliana	Cytoplasmic tRNA 2-thiolation protein 2	57.113%	Swiss-Prot	strong database homology
`A2ZM73`	Oryza sativa subsp. indica	Cytoplasmic tRNA 2-thiolation protein 2	48.267%	Swiss-Prot	moderate database homology
`Q2QMW0`	Oryza sativa subsp. japonica	Cytoplasmic tRNA 2-thiolation protein 2	48.020%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card