TkAUNG093660 | RubberDandelionOmics

Gene overview

TkAUNG093660

Reference: TK1151 Chr: ChrUn Coordinates: 26504686-26507905 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2401 bp · TkAUNG093660|TK1151|cDNA

TACCATTGTTGAAGGCTTTGGGCATTTCTCATTTGATACGTCACCAGCTGTGTAACGTGCTCTCACCTCCTGCTACTCTTTTGCCGCTCTCGTAAACCGACTTCTATTTCACTATTCCCAAACGTGTACTCCTCCGCAAAACAACAAGACAAATTTCTTCACAGCATCTTTCCACTCGTAAGTCCGGTTTCCGATCGTTTAATGCTTCCCACTTCTATTAGGGCGCCCTTAATTCTTCTCACATAAGCTGTTGTTACTTG...

CDS

Download CDS FASTA

1020 bp · TkAUNG093660|TK1151|CDS

ATGAACGATTGCAGATATCAGTTTTTCAAAGGTAAAATGGCTGAACAGGCAGGAACAGAGCTATCAGCATCTGCTTTTGACTACATGCTCTATGAAGGGGATCCTGAACATCTTCGAACAGTTAAAGCCACACCATCACAACCCAATCCTCGGATCGACTCATCTCTTTTAAAACTCAAGCACAGAATTGGACATGGACCTTTTGGTGATGTCTGGTTGGCTACTCATCATCAATCAGGACATGATTATGATGAGTATCA...

Protein

Download Protein FASTA

339 aa · TkAUNG093660|TK1151|PROTEIN

MNDCRYQFFKGKMAEQAGTELSASAFDYMLYEGDPEHLRTVKATPSQPNPRIDSSLLKLKHRIGHGPFGDVWLATHHQSGHDYDEYHEVAMKMLHPIKEEDIPKFLAKFDDLFLKIRKLQHVCWLHGISIISRKGFQHVCIAMKFYEGSVGDRMAKLKGGKLPLPDVLRYGVGLAKGIREVHSLGNLVLNIKPTNLLLNEHDEVVLGDFGIPYLLLGVQLPDPDMSLRVGSPNYMAPEQWDPEVRGPISLETDSWGFGSC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG093660`
TK1151 ID	TkAUNG093660
OH-1004 ID	LXL04_001992
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 81.416 / OH-1004 43.533 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG093660

Location ChrUn:26504686-26507905 (+)

Description Similar to KEG: E3 ubiquitin-protein ligase KEG

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32250`	Serine/threonine protein kinase acting as a regulatory component of the plastid protein import machinery by phosphorylating import receptors (e.g. the A-domain of TOC159, TOC120 and TOC132).	The novel chloroplast outer membrane kinase KOC1 is a required component of the plastid protein import machinery.2017 · DOI: 10.1074/jbc.m117.776468
`At5g01810`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0514200`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001992 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009704 de-etiolation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016197 endosomal transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032940 secretion by cell Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

KEGG gene cross-reference

ath:AT2G17700

ath:AT4G32250

ath:AT5G13530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.518

Rank 1 · TkAUNG093660 · TK1151

Nucleus0.394

Rank 2 · TkAUNG093660 · TK1151

Cell membrane0.123

Rank 3 · TkAUNG093660 · TK1151

Mitochondrion0.115

Rank 4 · TkAUNG093660 · TK1151

Endoplasmic reticulum0.073

Rank 5 · TkAUNG093660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr57-289 aa

PF00069Pkinase59-298 aa

PF17507DUF5439192-202 aa

PF17507DUF5439277-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG093660	`PF07714`	PK_Tyr_Ser-Thr	57	289	5.5e-20	72.5
TkAUNG093660	`PF00069`	Pkinase	59	298	2.6e-20	73.6
TkAUNG093660	`PF17507`	DUF5439	192	202	1.7	9.8
TkAUNG093660	`PF17507`	DUF5439	277	328	1.7	9.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWX4`	Arabidopsis thaliana	sp\|Q8RWX4\|KOC1_ARATH Protein KINASE OF THE OUTER CHLOROPLAST MEMBRANE 1	60.700%	Swiss-Prot	High
`P92937`	Arabidopsis thaliana	sp\|P92937\|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15	26.600%	Swiss-Prot	Low
`Q68Y49`	Oryza sativa subsp. japonica	sp\|Q68Y49\|CIPKJ_ORYSJ CBL-interacting protein kinase 19	24.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card