LXL04_001992 | RubberDandelionOmics

Gene overview

LXL04_001992

Reference: OH-1004 Chr: Chr01 Coordinates: 38546932-38549097 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1918 bp · LXL04_001992|LXL04_001992|OH1004|cDNA

TTTCAAAGGTAAAATGGCTGAACAGGCCGGAACAGAGCTATCAGCATCTGCTTTTGACTACATGCTCTATGAAGGGGATCCTGAACATCTTCGAACAGTTAAAGCCACACCATCACAACCCAATCCTCGGATCGACTCATCTCTTTTAAAACTCAAGCACAGAATTGGACATGGACCTTTTGGTGATGTCTGGTTGGCTACTCATCATCAATCAGGACATGATTATGATGAGTATCATGAAGTCGCCATGAAGATGTTAC...

CDS

Download CDS FASTA

1905 bp · LXL04_001992|LXL04_001992|OH1004|CDS

ATGGCTGAACAGGCCGGAACAGAGCTATCAGCATCTGCTTTTGACTACATGCTCTATGAAGGGGATCCTGAACATCTTCGAACAGTTAAAGCCACACCATCACAACCCAATCCTCGGATCGACTCATCTCTTTTAAAACTCAAGCACAGAATTGGACATGGACCTTTTGGTGATGTCTGGTTGGCTACTCATCATCAATCAGGACATGATTATGATGAGTATCATGAAGTCGCCATGAAGATGTTACATCCAATTAAAGA...

Protein

Download Protein FASTA

634 aa · LXL04_001992|LXL04_001992|OH1004|PROTEIN

MAEQAGTELSASAFDYMLYEGDPEHLRTVKATPSQPNPRIDSSLLKLKHRIGHGPFGDVWLATHHQSGHDYDEYHEVAMKMLHPIKEEDIPKFLAKFDDLFLKIRKLQHVCWLHGISIISRKGFQHVCIAMKFYEGSVGDRMAKLKGGKLPLPDVLRYGVGLAKGIREVHSLGNLVLNIKPTNLLLNEHDEVVLGDFGIPYLLLGVQLPDPDMSLRVGSPNYMAPEQWDPEVRGPISLETDSWGFGCCILEMLTGGQPWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001992`
TK1151 ID	TkAUNG093660
OH-1004 ID	LXL04_001992
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 81.416 / OH-1004 43.533 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001992

Location Chr01:38546932-38549097 (-)

Description Similar to KEG: E3 ubiquitin-protein ligase KEG

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32250`	Serine/threonine protein kinase acting as a regulatory component of the plastid protein import machinery by phosphorylating import receptors (e.g. the A-domain of TOC159, TOC120 and TOC132).	The novel chloroplast outer membrane kinase KOC1 is a required component of the plastid protein import machinery.2017 · DOI: 10.1074/jbc.m117.776468
`At5g13530`	Mediates E2-dependent protein ubiquitination.	Powdery mildew resistance conferred by loss of the ENHANCED DISEASE RESISTANCE1 protein kinase is suppressed by a missense mutation in KEEP ON GOING, a regulator of abscisic acid signaling.2008 · DOI: 10.1104/pp.108.127605
`At2g17700`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At4g38470`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At4g35780`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001992 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009704 de-etiolation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016197 endosomal transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032940 secretion by cell Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

KEGG gene cross-reference

ath:AT2G17700

ath:AT4G32250

ath:AT5G13530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.240

Rank 1 · LXL04_001992 · OH-1004

Nucleus0.210

Rank 2 · LXL04_001992 · OH-1004

Cell membrane0.205

Rank 3 · LXL04_001992 · OH-1004

Plastid0.158

Rank 4 · LXL04_001992 · OH-1004

Endoplasmic reticulum0.151

Rank 5 · LXL04_001992 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr45-313 aa

PF00069.32Pkinase47-312 aa

PF18346.8SH3_15355-461 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001992	`PF07714.24`	PK_Tyr_Ser-Thr	45	313	1.1e-24	87.9
LXL04_001992	`PF00069.32`	Pkinase	47	312	1.7e-22	80.8
LXL04_001992	`PF18346.8`	SH3_15	355	461	4.6e-07	30.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWX4`	Arabidopsis thaliana	Protein KINASE OF THE OUTER CHLOROPLAST MEMBRANE 1	56.240%	Swiss-Prot	strong database homology
`Q9FY48`	Arabidopsis thaliana	E3 ubiquitin-protein ligase KEG	30.847%	Swiss-Prot	weak database homology
`O22558`	Arabidopsis thaliana	Serine/threonine-protein kinase STY8	25.993%	Swiss-Prot	weak database homology
`F4JTP5`	Arabidopsis thaliana	Serine/threonine-protein kinase STY46	26.978%	Swiss-Prot	weak database homology
`Q8RWL6`	Arabidopsis thaliana	Serine/threonine-protein kinase STY17	26.642%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card