TkAUNG091680 | RubberDandelionOmics

Gene overview

TkAUNG091680

Reference: TK1151 Chr: ChrUn Coordinates: 25951989-25958629 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6410 bp · TkAUNG091680|TK1151|cDNA

ATTACGTCGTTTAAAAAAAAATGGTACACTTGGATGTAATGTTTACCAAATTACCCTAGAATCCCTGAAATCCCCCGCCGTATCTTTCTTTGCAAAAACAAAGCCGCCTCTTTCTCTCTCGCCGCCGCAAGAGAGAAAGAAGACGGTGCTAATCACGCCGGAACGTTCGTCAGGGTGCCATTATTGAAATTTCTATCAGTATCAGCTTAAACCCTAAACCTTCAATACTTATCTCGTGACTTAATAATGTCTGCAAAATG...

CDS

Download CDS FASTA

5976 bp · TkAUNG091680|TK1151|CDS

ATGTCTGCAAAATGGCGATCTTTACAGCATCGTCACCGCTACACTTACAGCGCAATCGTCTTTCCTCAATACTACAAACAAACTCTAGATGACTTCATTAAGTTGTCTGCATCTGAAGATCATGATGCCTCTGCTCGTGTGTTCTACTCGCAGCTCAACGAACTCGTTTCCCTCAATTCGACTTACGCGCAACTCAGTCACGCTAAAAAAATCGCTTTCGCTTTCACCGAGTTACTTAAAAATAGCAACGAGGTCGTTGT...

Protein

Download Protein FASTA

1991 aa · TkAUNG091680|TK1151|PROTEIN

MSAKWRSLQHRHRYTYSAIVFPQYYKQTLDDFIKLSASEDHDASARVFYSQLNELVSLNSTYAQLSHAKKIAFAFTELLKNSNEVVVSQASRFYLEILFLENSVPLHRTLVSVLAKTRDFQSVISDCFRSLCEEYADVNGNGNGKRKRFCVSRVGLSMMSSPKLGYLVEVVEECAILMSLDVVSSLNGVVLETNELSRPSPIVMEQCQEALSCIYYLLQRCPSKFTSLIGLQDSNIIENIITTILSILKSEAFSRDCFVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG091680`
TK1151 ID	TkAUNG091680
OH-1004 ID	LXL04_024070
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG091680`
Location	ChrUn:25951989-25958629 (+)
Description	Similar to THADA: Thyroid adenoma-associated protein homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024070` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002128 tRNA nucleoside ribose methylation Biological Process GO:0030488 tRNA methylation Biological Process GO:0032471 negative regulation of endoplasmic reticulum calcium ion concentration Biological Process GO:0055088 lipid homeostasis Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0030234 enzyme regulator activity Molecular Function
KEGG gene cross-reference	cfa:100126180 gga:421398 mmu:240174 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.593

Rank 1 · TkAUNG091680 · TK1151

Cytoplasm0.360

Rank 2 · TkAUNG091680 · TK1151

Cell membrane0.049

Rank 3 · TkAUNG091680 · TK1151

Mitochondrion0.048

Rank 4 · TkAUNG091680 · TK1151

Golgi apparatus0.044

Rank 5 · TkAUNG091680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12333Ipi1_N507-540 aa

PF02985HEAT525-539 aa

PF02985HEAT555-571 aa

PF25150TPR_Trm732556-854 aa

PF12333Ipi1_N661-687 aa

PF10350DUF24281000-1270 aa

PF02985HEAT1264-1284 aa

PF25151TPR_Trm732_C1272-1432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG091680	`PF12333`	Ipi1_N	507	540	0.14	13.3
TkAUNG091680	`PF02985`	HEAT	525	539	0.00068	20.4
TkAUNG091680	`PF02985`	HEAT	555	571	0.00068	20.4
TkAUNG091680	`PF25150`	TPR_Trm732	556	854	5.9e-20	72.5
TkAUNG091680	`PF12333`	Ipi1_N	661	687	0.14	13.3
TkAUNG091680	`PF10350`	DUF2428	1000	1270	2.1e-73	247.7
TkAUNG091680	`PF02985`	HEAT	1264	1284	0.00068	20.4
TkAUNG091680	`PF25151`	TPR_Trm732_C	1272	1432	2.2e-34	119.4
TkAUNG091680	`PF02985`	HEAT	1369	1396	0.00068	20.4
TkAUNG091680	`PF26719`	TPR_Atp25_C	1389	1485	0.00037	20.5
TkAUNG091680	`PF30095`	TBCD_C_yeast	1545	1601	0.033	14.1
TkAUNG091680	`PF25150`	TPR_Trm732	1550	1575	5.9e-20	72.5
TkAUNG091680	`PF02985`	HEAT	1553	1576	0.00068	20.4
TkAUNG091680	`PF25151`	TPR_Trm732_C	1603	1656	2.2e-34	119.4
TkAUNG091680	`PF25151`	TPR_Trm732_C	1670	1714	2.2e-34	119.4
TkAUNG091680	`PF26719`	TPR_Atp25_C	1680	1784	0.00037	20.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card