TkAUNG083220 | RubberDandelionOmics

Gene overview

TkAUNG083220

Reference: TK1151 Chr: ChrUn Coordinates: 23672823-23673698 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

840 bp · TkAUNG083220|TK1151|cDNA

ATGGAGTTGTCGTATGAAGAAGAATTACTTTCTTCCTGTGATCCCATACTGCCAGATGATGAAGAAAGGGATATTATCGATCAAGAACATGAAGAATTACAAGAACAAGAAGAAAAACGAGAAGCTTGTGGCCATCGTCGTGATGAAGATGCAAGATTGAATCAAGAACTCAATCTTTTAGACAGTTTAAACATGGGCGATCATTCATCGGAAAGTACAACTCCACAAGCATCGGATACAACCGAACCTAGGGTTTTTTC...

CDS

Download CDS FASTA

840 bp · TkAUNG083220|TK1151|CDS

ATGGAGTTGTCGTATGAAGAAGAATTACTTTCTTCCTGTGATCCCATACTGCCAGATGATGAAGAAAGGGATATTATCGATCAAGAACATGAAGAATTACAAGAACAAGAAGAAAAACGAGAAGCTTGTGGCCATCGTCGTGATGAAGATGCAAGATTGAATCAAGAACTCAATCTTTTAGACAGTTTAAACATGGGCGATCATTCATCGGAAAGTACAACTCCACAAGCATCGGATACAACCGAACCTAGGGTTTTTTC...

Protein

Download Protein FASTA

279 aa · TkAUNG083220|TK1151|PROTEIN

MELSYEEELLSSCDPILPDDEERDIIDQEHEELQEQEEKREACGHRRDEDARLNQELNLLDSLNMGDHSSESTTPQASDTTEPRVFSCNYCQRKFYSSQALGGHQNAHKRERNLAKRGQRMGFLSGPMISAAAAFGHSYMHQQQHHDQNYCSSLSSLPLHGYNNNRSLGIQVHSMIHKPSNSMFSSSSSSSPGFKSFYGGKGWSSRPHVDQHPAIGKLGLPSYASSLAAAPPSHGGVGRFEVVRTGMGGTGKDEIGGLWW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG083220`
TK1151 ID	TkAUNG083220
OH-1004 ID	LXL04_005353
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG083220

Location ChrUn:23672823-23673698 (-)

Description Similar to ZFP3: Zinc finger protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25160`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At1g80730`	May play a role in the regulation of shoot development, downstream of photomorphogenic activation (Probable).	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294 Expression analysis of an Arabidopsis C2H2 zinc finger protein gene.1996 · DOI: 10.1007/bf00020477
`At1g66140`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At1g24625`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At5g57520`	Transcription factor involved in the regulation of floral organ abscission and required for seed and silique development.	Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2.2008 · DOI: 10.1104/pp.107.110908 ZINC FINGER PROTEIN2 suppresses funiculus lignification to ensure seed loading efficiency in Arabidopsis.2025 · DOI: 10.1016/j.devcel.2025.01.021

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005353 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0060860 regulation of floral organ abscission Biological Process

GO:0060862 negative regulation of floral organ abscission Biological Process

GO:0080050 regulation of seed development Biological Process

GO:1901347 negative regulation of secondary cell wall biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G24625

ath:AT1G66140

ath:AT1G80730

ath:AT5G25160

ath:AT5G57520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkAUNG083220 · TK1151

Cytoplasm0.091

Rank 2 · TkAUNG083220 · TK1151

Cell membrane0.028

Rank 3 · TkAUNG083220 · TK1151

Endoplasmic reticulum0.019

Rank 4 · TkAUNG083220 · TK1151

Plastid0.011

Rank 5 · TkAUNG083220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13912zf-C2H2_685-110 aa

PF00096zf-C2H286-108 aa

PF13894zf-C2H2_486-108 aa

PF13912zf-C2H2_6140-147 aa

PF13894zf-C2H2_4141-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG083220	`PF13912`	zf-C2H2_6	85	110	0.00074	20.2
TkAUNG083220	`PF00096`	zf-C2H2	86	108	0.01	16.9
TkAUNG083220	`PF13894`	zf-C2H2_4	86	108	0.02	16.3
TkAUNG083220	`PF13912`	zf-C2H2_6	140	147	0.00074	20.2
TkAUNG083220	`PF13894`	zf-C2H2_4	141	146	0.02	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39262`	Arabidopsis thaliana	sp\|Q39262\|ZFP3_ARATH Zinc finger protein 3	50.000%	Swiss-Prot	Medium
`Q42485`	Arabidopsis thaliana	sp\|Q42485\|ZFP1_ARATH Zinc finger protein 1	57.100%	Swiss-Prot	Low
`Q39263`	Arabidopsis thaliana	sp\|Q39263\|ZFP4_ARATH Zinc finger protein 4	53.500%	Swiss-Prot	Low
`Q39266`	Arabidopsis thaliana	sp\|Q39266\|ZFP7_ARATH Zinc finger protein 7	51.100%	Swiss-Prot	Low
`Q39261`	Arabidopsis thaliana	sp\|Q39261\|ZFP2_ARATH Zinc finger protein 2	80.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card