TkAUNG080970 | RubberDandelionOmics

Gene overview

TkAUNG080970

Reference: TK1151 Chr: ChrUn Coordinates: 23073509-23073835 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

327 bp · TkAUNG080970|TK1151|cDNA

ATGGCTTTGAACTGCGAATCGACTTTTCATAACACAAAACCTTGTTGCAGTTGCACAGGCTGCTCTAGAAGCCTCTACACCATGGACCTCTGTTCTGCAAATGGGTTCGGAAAAATCAAAACGATCCTCCACAACACCTCTTTTACTCAGGCGATTCCAGGGTTGAAGGTTTTTATCATCGAGGAATGTCAGTCGTTAACAATGGATACATGGGATGAGTTAATGAGATTCTTCGAGGGGCCGTATGCTTCCAATCTTGT...

CDS

Download CDS FASTA

327 bp · TkAUNG080970|TK1151|CDS

ATGGCTTTGAACTGCGAATCGACTTTTCATAACACAAAACCTTGTTGCAGTTGCACAGGCTGCTCTAGAAGCCTCTACACCATGGACCTCTGTTCTGCAAATGGGTTCGGAAAAATCAAAACGATCCTCCACAACACCTCTTTTACTCAGGCGATTCCAGGGTTGAAGGTTTTTATCATCGAGGAATGTCAGTCGTTAACAATGGATACATGGGATGAGTTAATGAGATTCTTCGAGGGGCCGTATGCTTCCAATCTTGT...

Protein

Download Protein FASTA

108 aa · TkAUNG080970|TK1151|PROTEIN

MALNCESTFHNTKPCCSCTGCSRSLYTMDLCSANGFGKIKTILHNTSFTQAIPGLKVFIIEECQSLTMDTWDELMRFFEGPYASNLVFLLITTDAFGDRDRGIEAHCC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG080970`
TK1151 ID	TkAUNG080970
OH-1004 ID	LXL04_009078
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG080970`
Location	ChrUn:23073509-23073835 (+)
Description	Similar to At1g14460: Protein STICHEL-like 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009078` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006261 DNA-templated DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0010026 trichome differentiation Biological Process GO:0010091 trichome branching Biological Process GO:0005634 nucleus Cellular Component GO:0005663 DNA replication factor C complex Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009360 DNA polymerase III complex Cellular Component GO:0003677 DNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT1G14460 ath:AT2G02480 ath:AT4G24790 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.721

Rank 1 · TkAUNG080970 · TK1151

Cytoplasm0.283

Rank 2 · TkAUNG080970 · TK1151

Mitochondrion0.037

Rank 3 · TkAUNG080970 · TK1151

Extracellular0.023

Rank 4 · TkAUNG080970 · TK1151

Cell membrane0.019

Rank 5 · TkAUNG080970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13177DNA_pol3_delta22-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG080970	`PF13177`	DNA_pol3_delta2	2	94	2.1e-05	25.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card