LXL04_009078 | RubberDandelionOmics

Gene overview

LXL04_009078

Reference: OH-1004 Chr: Chr02 Coordinates: 117500539-117500865 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

327 bp · LXL04_009078|LXL04_009078|OH1004|cDNA

ATGGCTTTGAACTGCGAATCGACTTTTCATAACACAAAACCTTGTTGCAGTTGCAAAGGCTGCTCTAGAAGCCTCTACACCATGGACCTCTGTTCTGCAAATGGGTTCGGAAAAATCAAAACGATCCTCCACAACACCTCTTTTACTCAGGCGATTCCAGGGTTGAAGGTTTTTATCATCGAGGAATGTCAGTCGTTAACAATGGATACATGGGATGAGTTAATGAGATTCTTCGAGGGGCCGTATGCTTCCAATCTTGT...

CDS

Download CDS FASTA

327 bp · LXL04_009078|LXL04_009078|OH1004|CDS

ATGGCTTTGAACTGCGAATCGACTTTTCATAACACAAAACCTTGTTGCAGTTGCAAAGGCTGCTCTAGAAGCCTCTACACCATGGACCTCTGTTCTGCAAATGGGTTCGGAAAAATCAAAACGATCCTCCACAACACCTCTTTTACTCAGGCGATTCCAGGGTTGAAGGTTTTTATCATCGAGGAATGTCAGTCGTTAACAATGGATACATGGGATGAGTTAATGAGATTCTTCGAGGGGCCGTATGCTTCCAATCTTGT...

Protein

Download Protein FASTA

108 aa · LXL04_009078|LXL04_009078|OH1004|PROTEIN

MALNCESTFHNTKPCCSCKGCSRSLYTMDLCSANGFGKIKTILHNTSFTQAIPGLKVFIIEECQSLTMDTWDELMRFFEGPYASNLVFLLITTDAFGDRDRGIEAHCC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009078`
TK1151 ID	TkAUNG080970
OH-1004 ID	LXL04_009078
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009078

Location Chr02:117500539-117500865 (-)

Description Similar to At1g14460: Protein STICHEL-like 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14460`	Protein STICHEL-like 1.	No verified direct reference in this release
`At2g02480`	Acts as a key regulator of trichome branching through an endoreduplication-independent pathway.	No verified direct reference in this release
`At4g24790`	Protein STICHEL-like 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009078 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0010026 trichome differentiation Biological Process

GO:0010091 trichome branching Biological Process

GO:0005634 nucleus Cellular Component

GO:0005663 DNA replication factor C complex Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009360 DNA polymerase III complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003887 DNA-directed DNA polymerase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G14460

ath:AT2G02480

ath:AT4G24790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.738

Rank 1 · LXL04_009078 · OH-1004

Cytoplasm0.267

Rank 2 · LXL04_009078 · OH-1004

Mitochondrion0.037

Rank 3 · LXL04_009078 · OH-1004

Extracellular0.022

Rank 4 · LXL04_009078 · OH-1004

Cell membrane0.019

Rank 5 · LXL04_009078 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HW65`	Arabidopsis thaliana	Protein STICHEL-like 1	36.522%	Swiss-Prot	moderate database homology
`O64728`	Arabidopsis thaliana	Protein STICHEL	33.913%	Swiss-Prot	moderate database homology
`F4JRP8`	Arabidopsis thaliana	Protein STICHEL-like 2	29.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card