TkAUNG070040 | RubberDandelionOmics

Gene overview

TkAUNG070040

Reference: TK1151 Chr: ChrUn Coordinates: 20310784-20316541 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2833 bp · TkAUNG070040|TK1151|cDNA

CTCAGCTTCATAGACGCCATTTTTAGGGTTTTATTGTTTTTAATTCTTTGATTATTCCCAAAATCGAAAGTTTCTATCTTCCCGACAGACTGTTACAGCCACTGATTCCGCCACCGTGATTCACCAAGCCGAAGATGGAAGGACTTGGAGAAATCGGTTTGATAGGTGAAAACTTCGAAGGAAATCTCGGAAGGGTTAGAGGAGATGGATCTGAAAGCCGGTCCGGCGGAAGTGACAATGTCGAAGGTGCTTCCGGCGAC...

CDS

Download CDS FASTA

2424 bp · TkAUNG070040|TK1151|CDS

ATGAGTTTGGGGGGGTTTTACGGCGGCGGCGGTGGTCGTGGTGGCGATGGTCTTTTTAACAGTATGCCATTGCTCCGAGCTCCCATTTCTCAACCACAACTCATTACCTCGACTATTTACAACTCAGAATCCCTCTCCCTCGCTTTAAAGCCGAAGATGGAAGGACTTGGAGAAATCGGTTTGATAGGTGAAAACTTCGAAGGAAATCTCGGAAGGGTTAGAGGAGATGGATCTGAAAGCCGGTCCGGCGGAAGTGACAA...

Protein

Download Protein FASTA

807 aa · TkAUNG070040|TK1151|PROTEIN

MSLGGFYGGGGGRGGDGLFNSMPLLRAPISQPQLITSTIYNSESLSLALKPKMEGLGEIGLIGENFEGNLGRVRGDGSESRSGGSDNVEGASGDEQDVPPGPSSSSRRRQKYHRHTPYQIQELESSFKDNPHPDEKERLALGKKLNLENKQVKFWFQNRRTQMKTQLERHENAILKQENDKLRIENIAMKEAIRAPVCNNCGGQAILGDISIDEHHLRIENARLRDELSRISILANKFLGRPLSSFSGNMPPGMAANSNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG070040`
TK1151 ID	TkAUNG070040
OH-1004 ID	LXL04_021674
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG070040

Location ChrUn:20310784-20316541 (+)

Description Similar to ANL2: Homeobox-leucine zipper protein ANTHOCYANINLESS 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61150`	Probable transcription factor (By similarity).	CFL1, a WW domain protein, regulates cuticle development by modulating the function of HDG1, a class IV homeodomain transcription factor, in rice and Arabidopsis.2011 · DOI: 10.1105/tpc.111.088625 Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211
`At4g00730`	Probable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root.	ANTHOCYANINLESS2, a homeobox gene affecting anthocyanin distribution and root development in Arabidopsis.1999 · DOI: 10.1105/tpc.11.7.1217

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0674800`	Probable transcription factor.	No verified direct reference in this release
`Os09g0526300`	Probable transcription factor.	No verified direct reference in this release
`Os04g0569100`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021674 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0043481 anthocyanin accumulation in tissues in response to UV light Biological Process

GO:0048364 root development Biological Process

GO:0048497 maintenance of floral organ identity Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G61150

ath:AT4G00730

dosa:Os02g0674800

dosa:Os04g0569100

dosa:Os09g0526300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.949

Rank 1 · TkAUNG070040 · TK1151

Cytoplasm0.102

Rank 2 · TkAUNG070040 · TK1151

Cell membrane0.035

Rank 3 · TkAUNG070040 · TK1151

Plastid0.019

Rank 4 · TkAUNG070040 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkAUNG070040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046Homeodomain109-164 aa

PF11569Homez117-161 aa

PF05920Homeobox_KN129-161 aa

PF23204KIF21A_2nd170-195 aa

PF01852START325-545 aa

PF25797PDF2_C564-797 aa

PF01852START625-740 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG070040	`PF00046`	Homeodomain	109	164	1.2e-18	67.3
TkAUNG070040	`PF11569`	Homez	117	161	0.19	12.2
TkAUNG070040	`PF05920`	Homeobox_KN	129	161	4.5e-05	23.9
TkAUNG070040	`PF23204`	KIF21A_2nd	170	195	0.12	13.3
TkAUNG070040	`PF01852`	START	325	545	1.2e-39	136.6
TkAUNG070040	`PF25797`	PDF2_C	564	797	2.5e-77	260.0
TkAUNG070040	`PF01852`	START	625	740	1.2e-39	136.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2E8`	Arabidopsis thaliana	sp\|Q9M2E8\|HDG1_ARATH Homeobox-leucine zipper protein HDG1	50.400%	Swiss-Prot	High
`Q0WV12`	Arabidopsis thaliana	sp\|Q0WV12\|ANL2_ARATH Homeobox-leucine zipper protein ANTHOCYANINLESS 2	49.400%	Swiss-Prot	Medium
`Q6EPF0`	Oryza sativa subsp. japonica	sp\|Q6EPF0\|ROC5_ORYSJ Homeobox-leucine zipper protein ROC5	50.000%	Swiss-Prot	High
`Q7Y0V7`	Oryza sativa subsp. japonica	sp\|Q7Y0V7\|ROC6_ORYSJ Homeobox-leucine zipper protein ROC6	47.800%	Swiss-Prot	Medium
`Q7Y0V9`	Oryza sativa subsp. japonica	sp\|Q7Y0V9\|ROC4_ORYSJ Homeobox-leucine zipper protein ROC4	50.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card