LXL04_021674 | RubberDandelionOmics

Gene overview

LXL04_021674

Reference: OH-1004 Chr: Chr04 Coordinates: 134666514-134670947 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2439 bp · LXL04_021674|LXL04_021674|OH1004|cDNA

ATGAGTTTTGGGGGGTTTTAcggcggcggcggcggtggtcgTGGTGGCGATGGTTCTTTGAACAGTATGCCATTGCTCCGAGCTCCCATTTCTCAACCACAACTCATTACCTCGACTATTTACAACTCAGAATCCCTCTCCCTCGCTTTAGTATGCATTCTCAAGCCGAAGATGGAAGGACTTGGAGAAATCGGTTTGATAGGTGAAAACTTCGAAGGAAATCTCGGAAGGGTTAGAGGAGATGGATCTGAAAGCCGGTC...

CDS

Download CDS FASTA

2439 bp · LXL04_021674|LXL04_021674|OH1004|CDS

ATGAGTTTTGGGGGGTTTTACGGCGGCGGCGGCGGTGGTCGTGGTGGCGATGGTTCTTTGAACAGTATGCCATTGCTCCGAGCTCCCATTTCTCAACCACAACTCATTACCTCGACTATTTACAACTCAGAATCCCTCTCCCTCGCTTTAGTATGCATTCTCAAGCCGAAGATGGAAGGACTTGGAGAAATCGGTTTGATAGGTGAAAACTTCGAAGGAAATCTCGGAAGGGTTAGAGGAGATGGATCTGAAAGCCGGTC...

Protein

Download Protein FASTA

812 aa · LXL04_021674|LXL04_021674|OH1004|PROTEIN

MSFGGFYGGGGGGRGGDGSLNSMPLLRAPISQPQLITSTIYNSESLSLALVCILKPKMEGLGEIGLIGENFEGNLGRVRGDGSESRSGGSDNVEGASGDEQDVPPGPSSSSRRRQKYHRHTPYQIQELESSFKDNPHPDEKERLALGKKLNLENKQVKFWFQNRRTQMKTQLERHENAILKQENDKLRIENIAMKEAIRAPVCNNCGGQAILGDISIDEHHLRIENARLRDELSRISILANKFLGRPLSSFSGNMPPGMA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021674`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021674

Location Chr04:134666514-134670947 (-)

Description Similar to ANL2: Homeobox-leucine zipper protein ANTHOCYANINLESS 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00730`	Probable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root.	ANTHOCYANINLESS2, a homeobox gene affecting anthocyanin distribution and root development in Arabidopsis.1999 · DOI: 10.1105/tpc.11.7.1217
`At3g61150`	Probable transcription factor (By similarity).	CFL1, a WW domain protein, regulates cuticle development by modulating the function of HDG1, a class IV homeodomain transcription factor, in rice and Arabidopsis.2011 · DOI: 10.1105/tpc.111.088625 Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12211

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0674800`	Probable transcription factor.	No verified direct reference in this release
`Os04g0569100`	Probable transcription factor.	No verified direct reference in this release
`Os09g0526300`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021674 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0043481 anthocyanin accumulation in tissues in response to UV light Biological Process

GO:0048364 root development Biological Process

GO:0048497 maintenance of floral organ identity Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G61150

ath:AT4G00730

dosa:Os02g0674800

dosa:Os04g0569100

dosa:Os09g0526300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.943

Rank 1 · LXL04_021674 · OH-1004

Cytoplasm0.108

Rank 2 · LXL04_021674 · OH-1004

Cell membrane0.037

Rank 3 · LXL04_021674 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_021674 · OH-1004

Plastid0.020

Rank 5 · LXL04_021674 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00046.36Homeodomain114-169 aa

PF01852.26START330-550 aa

PF25797.2PDF2_C569-802 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021674	`PF00046.36`	Homeodomain	114	169	1.2e-18	67.3
LXL04_021674	`PF01852.26`	START	330	550	8.9e-40	137.0
LXL04_021674	`PF25797.2`	PDF2_C	569	802	2.5e-77	259.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WV12`	Arabidopsis thaliana	Homeobox-leucine zipper protein ANTHOCYANINLESS 2	51.847%	Swiss-Prot	strong database homology
`Q9M2E8`	Arabidopsis thaliana	Homeobox-leucine zipper protein HDG1	48.019%	Swiss-Prot	moderate database homology
`Q6EPF0`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein ROC5	49.867%	Swiss-Prot	moderate database homology
`Q7Y0V9`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein ROC4	50.414%	Swiss-Prot	strong database homology
`Q7Y0V7`	Oryza sativa subsp. japonica	Homeobox-leucine zipper protein ROC6	47.864%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card