TkAUNG065570 | RubberDandelionOmics

Gene overview

TkAUNG065570

Reference: TK1151 Chr: ChrUn Coordinates: 19037298-19040750 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1563 bp · TkAUNG065570|TK1151|cDNA

ATGGCTCCTCAATCTGATTCAATGCTACAAAACCAACAGGGAAAATATATTCGGGGTCGTGAAAAAAGGAACGGCAATCAGAGAATTTCACGTTCCACCTCTGTAATCGGTCATGCCGGGTGTAAAGGTGAAATTCCAGAAAACTCACCATACAGTTCATCAAAAGGTTCACAGTTGCACATAAGAGAAGAGCCTTTCGGCCTGCCTTTATCTCGAGGTGTTGATTTAGGTTCATCTCAGACACCAGATGTGTACTCAGA...

CDS

Download CDS FASTA

1563 bp · TkAUNG065570|TK1151|CDS

ATGGCTCCTCAATCTGATTCAATGCTACAAAACCAACAGGGAAAATATATTCGGGGTCGTGAAAAAAGGAACGGCAATCAGAGAATTTCACGTTCCACCTCTGTAATCGGTCATGCCGGGTGTAAAGGTGAAATTCCAGAAAACTCACCATACAGTTCATCAAAAGGTTCACAGTTGCACATAAGAGAAGAGCCTTTCGGCCTGCCTTTATCTCGAGGTGTTGATTTAGGTTCATCTCAGACACCAGATGTGTACTCAGA...

Protein

Download Protein FASTA

520 aa · TkAUNG065570|TK1151|PROTEIN

MAPQSDSMLQNQQGKYIRGREKRNGNQRISRSTSVIGHAGCKGEIPENSPYSSSKGSQLHIREEPFGLPLSRGVDLGSSQTPDVYSESSIDMITRRDPEANGVHGDREEPLIEKPYADSKRKQTLPVVSLPLPPSAASFYYPCTPRMDVVESCQSIKRLNSYLKACKDAVNAGVPGQFLRAVLGQVSDVGSFISTIMYSFYLNETDKSSQFCTVPVINIKRADLKSHADLEWLLFSCNIEQPSILFIDEIDLSYYNLFGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG065570`
TK1151 ID	TkAUNG065570
OH-1004 ID	LXL04_033780
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.800
Protein coverage (%)	TK1151 95.769 / OH-1004 84.130 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG065570`
Location	ChrUn:19037298-19040750 (-)
Description	Similar to PRUNE1: Exopolyphosphatase PRUNE1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033780` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0031113 regulation of microtubule polymerization Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005925 focal adhesion Cellular Component GO:0004309 exopolyphosphatase activity Molecular Function GO:0004427 inorganic diphosphate phosphatase activity Molecular Function GO:0015631 tubulin binding Molecular Function GO:0016462 pyrophosphatase activity Molecular Function GO:0016791 phosphatase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	bta:524973 hsa:158471 hsa:58497 mmu:229589 rno:310664 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.515

Rank 1 · TkAUNG065570 · TK1151

Cytoplasm0.398

Rank 2 · TkAUNG065570 · TK1151

Cell membrane0.108

Rank 3 · TkAUNG065570 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkAUNG065570 · TK1151

Golgi apparatus0.055

Rank 5 · TkAUNG065570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02833DHHA2117-128 aa

PF00004AAA212-251 aa

PF02833DHHA2385-475 aa

PF00004AAA410-480 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG065570	`PF02833`	DHHA2	117	128	1e-05	26.7
TkAUNG065570	`PF00004`	AAA	212	251	0.032	15.4
TkAUNG065570	`PF02833`	DHHA2	385	475	1e-05	26.7
TkAUNG065570	`PF00004`	AAA	410	480	0.032	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card