Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1761 bp · LXL04_033780|LXL04_033780|OH1004|cDNA
ATGGTTGGAACGGCGGATTCCACtagaaagaagaagaagaagaattcAATAATATCTCATATTGTCATCTTATTCTTTGTTTATCTTCCGCTATGCCGTTTCTATCCCTCCAGAAACCACAATCTCGCTCATTGTGCGACCGTTTATGCGTTTCTCCTACTTCGATTCcgtgctaattttccatctcGGGCATGGCTCCTCAATCTGATTCAATGCTACAAAACCAACAGAGGTAACACCTCTTTGACGAACAGAACATC...
1761 bp · LXL04_033780|LXL04_033780|OH1004|CDS
ATGGTTGGAACGGCGGATTCCACTAGAAAGAAGAAGAAGAAGAATTCAATAATATCTCATATTGTCATCTTATTCTTTGTTTATCTTCCGCTATGCCGTTTCTATCCCTCCAGAAACCACAATCTCGCTCATTGTGCGACCGTTTATGCGTTTCTCCTACTTCGATTCCGTGCTAATTTTCCATCTCGGGCATGGCTCCTCAATCTGATTCAATGCTACAAAACCAACAGAGGTAACACCTCTTTGACGAACAGAACATC...
Protein
Download Protein FASTA586 aa · LXL04_033780|LXL04_033780|OH1004|PROTEIN
MVGTADSTRKKKKKNSIISHIVILFFVYLPLCRFYPSRNHNLAHCATVYAFLLLRFRANFPSRAWLLNLIQCYKTNRGNTSLTNRTSIFDFLGRNGNQRISRSTSVIGHAGCKGEIPENSPYSSSKGSQLHIREEPFGLPLSRGVDLGSSQTPDVYSESSIDMITRRDPEANGVHGDREEPLIEKPYADSKRKQTLPVVSLPLPPSAASFYYPCTPRMDVVESCQSIKRLNSYLKACKDAVNAGVPGQFLRAVLGQVSDV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_033780 |
|---|---|
| TK1151 ID | TkAUNG065570 |
| OH-1004 ID | LXL04_033780 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 98.800 |
| Protein coverage (%) | TK1151 95.769 / OH-1004 84.130Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_033780 |
|---|---|
| Location | Chr07:57170729-57174375 (-) |
| Description | Similar to PRUNE1: Exopolyphosphatase PRUNE1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0031113 regulation of microtubule polymerization Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005925 focal adhesion Cellular Component GO:0004309 exopolyphosphatase activity Molecular Function GO:0004427 inorganic diphosphate phosphatase activity Molecular Function GO:0015631 tubulin binding Molecular Function GO:0016462 pyrophosphatase activity Molecular Function GO:0016791 phosphatase activity Molecular Function GO:0046872 metal ion binding Molecular Function |
| KEGG gene cross-reference | bta:524973 hsa:158471 hsa:58497 mmu:229589 rno:310664 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.