TkAUNG064580 | RubberDandelionOmics

Gene overview

TkAUNG064580

Reference: TK1151 Chr: ChrUn Coordinates: 18785971-18786495 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · TkAUNG064580|TK1151|cDNA

ATGAACTACGTCACAACCTCATGCAAAATCACCCGCTACTCATCTCTCTGTATCCGTTGTCTTTCAAAATACGCCGATTCCATCCAAGGAAACGATCTAAAGCTCGCCAAATCAGCCATTTCCGTAAGCCTATACAACGCCAATTCCACAACAGCCTACATTTTAAAACTGGCGGCGTCTTCAGGGCTGAAACCCACCATGTCGCAAGCCGTGAAAGACTGTGTCAACAACATGAACAACTGCGTGTCGAGCCTGAGCCA...

CDS

Download CDS FASTA

525 bp · TkAUNG064580|TK1151|CDS

ATGAACTACGTCACAACCTCATGCAAAATCACCCGCTACTCATCTCTCTGTATCCGTTGTCTTTCAAAATACGCCGATTCCATCCAAGGAAACGATCTAAAGCTCGCCAAATCAGCCATTTCCGTAAGCCTATACAACGCCAATTCCACAACAGCCTACATTTTAAAACTGGCGGCGTCTTCAGGGCTGAAACCCACCATGTCGCAAGCCGTGAAAGACTGTGTCAACAACATGAACAACTGCGTGTCGAGCCTGAGCCA...

Protein

Download Protein FASTA

174 aa · TkAUNG064580|TK1151|PROTEIN

MNYVTTSCKITRYSSLCIRCLSKYADSIQGNDLKLAKSAISVSLYNANSTTAYILKLAASSGLKPTMSQAVKDCVNNMNNCVSSLSQSIQELEKMAQFKGESFEWHMSNIKTWVSSALTNQNTCGRGFSDGSVVDGPVKDAVVRRMKYVAQLTSNALALVNRFALRHKAGTHMP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG064580`
TK1151 ID	TkAUNG064580
OH-1004 ID	LXL04_029715
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 33.852 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG064580

Location ChrUn:18785971-18786495 (-)

Description Similar to PMEI9: Pectinesterase inhibitor 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62760`	Pectin methylesterase (PME) inhibitor involved in the maintenance of cell wall integrity in response to necrotrophic pathogens.	No verified direct reference in this release
`At1g62770`	Pectin methylesterase (PME) inhibitor that probably targets root-expressed PME and PME3 in a moderate pH-dependent manner, mainly in slightly acidic conditions (pH 6.3 and 5.0) and to some extent at pH 7.5.	Combined Experimental and Computational Approaches Reveal Distinct pH Dependence of Pectin Methylesterase Inhibitors.2017 · DOI: 10.1104/pp.16.01790
`At4g25250`	Pectin methylesterase (PME) inhibitor that can target the root-expressed PME17 and PME3 in a pH-dependent manner, mainly in slightly acidic conditions (pH 6.3 and 5.0) but not at pH 7.5; this processus relies on changes in the protonation of amino acids involved in intermolecular and intramolecular interactions.	Arabidopsis PME17 Activity can be Controlled by Pectin Methylesterase Inhibitor4.2015 · DOI: 10.4161/15592324.2014.983351 Combined Experimental and Computational Approaches Reveal Distinct pH Dependence of Pectin Methylesterase Inhibitors.2017 · DOI: 10.1104/pp.16.01790
`At2g47670`	Pectin methylesterase (PME) inhibitor that targets PME from seeds and modulates PME activity and pectin methylesterification during seed germination.	PECTIN METHYLESTERASE INHIBITOR6 promotes Arabidopsis mucilage release by limiting methylesterification of homogalacturonan in seed coat epidermal cells.2013 · DOI: 10.1105/tpc.112.106575

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029715 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009827 plant-type cell wall modification Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

GO:0046910 pectinesterase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G62770

ath:AT3G47380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.514

Rank 1 · TkAUNG064580 · TK1151

Endoplasmic reticulum0.155

Rank 2 · TkAUNG064580 · TK1151

Cytoplasm0.152

Rank 3 · TkAUNG064580 · TK1151

Lysosome / Vacuole0.102

Rank 4 · TkAUNG064580 · TK1151

Cell membrane0.073

Rank 5 · TkAUNG064580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21558Pept_S41_N_bact1-43 aa

PF04043PMEI3-159 aa

PF20168PDS529-123 aa

PF22998GNAT_LYC1-like45-120 aa

PF06705SF-assemblin64-144 aa

PF21521MYO6_lever68-118 aa

PF21558Pept_S41_N_bact80-116 aa

PF21558Pept_S41_N_bact134-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG064580	`PF21558`	Pept_S41_N_bact	1	43	0.026	15.2
TkAUNG064580	`PF04043`	PMEI	3	159	1.1e-36	127.0
TkAUNG064580	`PF20168`	PDS5	29	123	0.02	13.4
TkAUNG064580	`PF22998`	GNAT_LYC1-like	45	120	0.13	12.6
TkAUNG064580	`PF06705`	SF-assemblin	64	144	0.23	11.5
TkAUNG064580	`PF21521`	MYO6_lever	68	118	0.018	16.1
TkAUNG064580	`PF21558`	Pept_S41_N_bact	80	116	0.026	15.2
TkAUNG064580	`PF21558`	Pept_S41_N_bact	134	155	0.026	15.2
TkAUNG064580	`PF21521`	MYO6_lever	146	149	0.018	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SI74`	Arabidopsis thaliana	sp\|Q9SI74\|PMI10_ARATH Pectinesterase inhibitor 10	42.700%	Swiss-Prot	Medium
`Q9SI72`	Arabidopsis thaliana	sp\|Q9SI72\|PMEI9_ARATH Pectinesterase inhibitor 9	43.000%	Swiss-Prot	Medium
`Q9SB38`	Arabidopsis thaliana	sp\|Q9SB38\|PMEI4_ARATH Pectinesterase inhibitor 4	31.500%	Swiss-Prot	Medium
`O22244`	Arabidopsis thaliana	sp\|O22244\|PMEI6_ARATH Pectinesterase inhibitor 6	30.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card