TkAUNG063060 | RubberDandelionOmics

Gene overview

TkAUNG063060

Reference: TK1151 Chr: ChrUn Coordinates: 18223482-18226171 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1854 bp · TkAUNG063060|TK1151|cDNA

TAGAGGTATACGTATTGCTCAATAATTGGCTGTTTTAACATCCCGCAAGAACCTTAGCACATATCTTACACATAAAGTCATAAACACCACAACGAACACGCAGACGCATTACACAATTCATCCCAAATTCCAGATTCACATATACATGCATCTGGCGTATACATATATATATTCCACAAATACGAACTGTAAATCTGAAATGAGACGATGAAGGTATTGAAGACGGTCTCGGTTATGGATTTGGTAGCATGGAGACGGTT...

CDS

Download CDS FASTA

1470 bp · TkAUNG063060|TK1151|CDS

ATGAAGGTATTGAAGACGGTCTCGGTTATGGATTTGGTAGCATGGAGACGGTTAGTGTCTGTATTCATCCTCCAGGTCGTCTTCTCTCTTCAGCCACTCGTTTACGCCCTAGATGGGAACACAGGGGATGCTGTTGAATTGTTTGAGAGAGCTTCGCGTAATATGGAAGTGAAACGTTATAATGATGCAATTGATGATCTTAACGCTGCAATAGAAGCTGATCCGTTACTATCTGAAGCATACTGGAGTCGAGCTTTAGT...

Protein

Download Protein FASTA

489 aa · TkAUNG063060|TK1151|PROTEIN

MKVLKTVSVMDLVAWRRLVSVFILQVVFSLQPLVYALDGNTGDAVELFERASRNMEVKRYNDAIDDLNAAIEADPLLSEAYWSRALVLRHLCRYKESEESYKKFLQMKPQNSAVEKELSQLHQAQSALDTATNLFEHNDYTKALDFIDKVVLVFSPACSQAKILKAKLLLAAKDYSGVISESGYMLKEDEDNLEALLLRGRAYYYLADHDVATRHYQKGLRLDPEHTELKKSYFGLKNLLKKTKSAEDNEKKGKLRVAVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG063060`
TK1151 ID	TkAUNG063060
OH-1004 ID	LXL04_032682
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.600
Protein coverage (%)	TK1151 99.182 / OH-1004 91.353 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG063060

Location ChrUn:18223482-18226171 (-)

Description Similar to P58IPK: DnaJ protein P58IPK homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03160`	Plays an important positive role in viral symptom development and is required for viral multiplication and pathogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0977200`	May play a role in protein folding in the endoplasmic reticulum.	Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.2013 · DOI: 10.1093/jxb/ert312
`Os02g0195300`	May play a role in protein folding in the endoplasmic reticulum.	Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.2013 · DOI: 10.1093/jxb/ert312

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032682 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006986 response to unfolded protein Biological Process

GO:0034975 protein folding in endoplasmic reticulum Biological Process

GO:0036494 positive regulation of translation initiation in response to endoplasmic reticulum stress Biological Process

GO:0044794 host-mediated activation of viral process Biological Process

GO:0070417 cellular response to cold Biological Process

GO:1903912 negative regulation of endoplasmic reticulum stress-induced eIF2 alpha phosphorylation Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004860 protein kinase inhibitor activity Molecular Function

GO:0019901 protein kinase binding Molecular Function

GO:0051087 protein-folding chaperone binding Molecular Function

KEGG gene cross-reference

ath:AT5G03160

bta:286770

dosa:Os01g0977200

dosa:Os02g0195300

gga:418787

osa:4327812

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.410

Rank 1 · TkAUNG063060 · TK1151

Cytoplasm0.228

Rank 2 · TkAUNG063060 · TK1151

Mitochondrion0.137

Rank 3 · TkAUNG063060 · TK1151

Nucleus0.116

Rank 4 · TkAUNG063060 · TK1151

Peroxisome0.110

Rank 5 · TkAUNG063060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07719TPR_234-51 aa

PF00515TPR_134-51 aa

PF13424TPR_1234-55 aa

PF13176TPR_734-51 aa

PF13181TPR_835-51 aa

PF13428TPR_1435-52 aa

PF13174TPR_635-51 aa

PF14559TPR_1938-51 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG063060	`PF07719`	TPR_2	34	51	6.7e-26	88.9
TkAUNG063060	`PF00515`	TPR_1	34	51	2.9e-21	75.0
TkAUNG063060	`PF13424`	TPR_12	34	55	1.4e-06	29.1
TkAUNG063060	`PF13176`	TPR_7	34	51	0.0015	19.2
TkAUNG063060	`PF13181`	TPR_8	35	51	1.1e-14	53.9
TkAUNG063060	`PF13428`	TPR_14	35	52	6.5e-12	45.6
TkAUNG063060	`PF13174`	TPR_6	35	51	0.0052	18.1
TkAUNG063060	`PF14559`	TPR_19	38	51	7.9e-15	55.7
TkAUNG063060	`PF13432`	TPR_16	39	53	5.9e-15	56.1
TkAUNG063060	`PF14863`	Alkyl_sulf_dimr	42	106	4.9e-05	24.5
TkAUNG063060	`PF13371`	TPR_9	43	75	8.1e-11	42.5
TkAUNG063060	`PF07719`	TPR_2	46	75	6.7e-26	88.9
TkAUNG063060	`PF13428`	TPR_14	47	81	6.5e-12	45.6
TkAUNG063060	`PF24575`	TPR_Slam	48	77	0.00032	21.8
TkAUNG063060	`PF03704`	BTAD	49	106	9.3e-05	23.5
TkAUNG063060	`PF31234`	TPR_Psidin_N	54	137	0.0012	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYW9`	Arabidopsis thaliana	sp\|Q9LYW9\|DNJ36_ARATH DnaJ protein P58IPK homolog	67.200%	Swiss-Prot	High
`Q5JNB5`	Oryza sativa subsp. japonica	sp\|Q5JNB5\|DJC15_ORYSJ DnaJ protein P58IPK homolog B	67.100%	Swiss-Prot	High
`A0A0P0VG31`	Oryza sativa subsp. japonica	sp\|A0A0P0VG31\|DJC16_ORYSJ DnaJ protein P58IPK homolog A	66.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card