Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2373 bp · TkAUNG063020|TK1151|cDNA
CCATAATCCTACATGGCTTTCAATTTGGTTTTGGAAAAAACTTGAAAGTGGCGATGTGGATGAACTTAGCCAAATAAACAAAAAAAGTAAAGGCAAAAAAGCTCTGATTTTTCCTTTGGGAAATTTGTATATGAACACCACCAGAGACCTGTCCCTGTTTACCTACGACAGTTTCACTTCAATTATCAATTAATTTCCATTCGCAAATTTGATTCTTCAGCATCTATAAGCCCCAAAAATCAACTCACCGGATCATCACC...
1644 bp · TkAUNG063020|TK1151|CDS
ATGATCAGTGCGTCCAACCCTAATTCAATGATGTCTTCGTCGTCAACAACAGGCAACAACAACGCTGCCGGCAGCGGACAACAAGCGCCGGGTTTGAAGACGTATTTCAAAACTCCGGAAGGAAGGTATAAGCTTAAGTACGAGAAAAGTCATCCCGCCGGTCTCCTTCACTACGCCCATGGCAAATCTGTTACCCAGGTGACTCTGGCTCATCTTAAGGATAAACCTGCACATGCTCTATCATCTTCATCTTCTAGTAT...
Protein
Download Protein FASTA547 aa · TkAUNG063020|TK1151|PROTEIN
MISASNPNSMMSSSSTTGNNNAAGSGQQAPGLKTYFKTPEGRYKLKYEKSHPAGLLHYAHGKSVTQVTLAHLKDKPAHALSSSSSSIGISSGVKSAAAKLLGGGNGSRALSFVGGNGGSKSSSGTTKVGSLGSSYTNSYTPNSNFDGKGTYLIFNVGDAIFISDLNSQDKDPIKSINFSTSNPISHAFDPDAKDGHDLLIGLNCGDVYSVSLRQQLQDGGKKLVGGQHYNKDGCVNNSRCTSIAWVPNGDGTFVVAHADG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG063020 |
|---|---|
| TK1151 ID | TkAUNG063020 |
| OH-1004 ID | LXL04_032681 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 97.400 |
| Protein coverage (%) | TK1151 99.634 / OH-1004 98.175Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG063020 |
|---|---|
| Location | ChrUn:18213870-18218400 (-) |
| Description | Similar to creC: Catabolite repression protein creC (Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0045013 carbon catabolite repression of transcription Biological Process GO:0090263 positive regulation of canonical Wnt signaling pathway Biological Process GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0032153 cell division site Cellular Component GO:0051286 cell tip Cellular Component GO:0035800 deubiquitinase activator activity Molecular Function |
| KEGG gene cross-reference | act:ACLA_082740 ang:An11g02750 hsa:91833 nfi:NFIA_053550 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF26550Tricorn_2nd127-154 aaPF24814WD40_Prp19142-193 aaPF25174Beta-prop_THOC3144-192 aaPF24796WDR55147-176 aaPF25171Beta-prop_WDR36-Utp21_1st148-207 aaPF25175Beta-prop_WDR5151-180 aaPF23775Beta-prop_RIG_2nd151-366 aaPF24807WD40_CDC20-Fz156-337 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG063020 | PF26550 | Tricorn_2nd | 127 | 154 | 0.0026 | 17.3 |
| TkAUNG063020 | PF24814 | WD40_Prp19 | 142 | 193 | 1.3e-11 | 44.8 |
| TkAUNG063020 | PF25174 | Beta-prop_THOC3 | 144 | 192 | 2.5e-20 | 73.3 |
| TkAUNG063020 | PF24796 | WDR55 | 147 | 176 | 1.9e-09 | 37.7 |
| TkAUNG063020 | PF25171 | Beta-prop_WDR36-Utp21_1st | 148 | 207 | 7.9e-07 | 29.5 |
| TkAUNG063020 | PF25175 | Beta-prop_WDR5 | 151 | 180 | 6.9e-15 | 55.8 |
| TkAUNG063020 | PF23775 | Beta-prop_RIG_2nd | 151 | 366 | 6.7e-06 | 26.4 |
| TkAUNG063020 | PF24807 | WD40_CDC20-Fz | 156 | 337 | 3.8e-09 | 37.0 |
| TkAUNG063020 | PF16755 | Beta-prop_NUP159_NUP214 | 159 | 282 | 0.0046 | 17.0 |
| TkAUNG063020 | PF24105 | Beta-prop_CAF1B_HIR1 | 162 | 182 | 2.2e-05 | 24.3 |
| TkAUNG063020 | PF30552 | CFAP251_N | 168 | 183 | 0.019 | 14.8 |
| TkAUNG063020 | PF23381 | Beta-prop_IFT122_1st | 180 | 269 | 2e-14 | 54.3 |
| TkAUNG063020 | PF23414 | Beta-prop_EML_2 | 193 | 270 | 2.6e-12 | 47.4 |
| TkAUNG063020 | PF16755 | Beta-prop_NUP159_NUP214 | 212 | 377 | 0.0046 | 17.0 |
| TkAUNG063020 | PF12894 | ANAPC4_WD40 | 232 | 267 | 3.3e-08 | 34.4 |
| TkAUNG063020 | PF24805 | EIF3I | 235 | 269 | 4.4e-06 | 26.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.