LXL04_032681 | RubberDandelionOmics

Gene overview

LXL04_032681

Reference: OH-1004 Chr: Chr07 Coordinates: 27760349-27764219 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1647 bp · LXL04_032681|LXL04_032681|OH1004|cDNA

ATGATCAGTGCGTCCAACCCTAATTCAATGATGTCTTCGTCGTCAACAACAGGCAATAACAACGCTGCCGGCAGCGGCCAACAAGCGCCGGGTTTGAAGACGTATTTCAAAACTCCGGAAGGAAGGTATAAGCTTAAGTACGAGAAAAGTCATCCCGCCGGTCTCCTTCACTACGCCCATGGCAAATCTGTTACCCAGGTGACTCTGGCTCATCTTAAGGATAAACCTGCACATGCTctatcatcttcatcttcaagtat...

CDS

Download CDS FASTA

1647 bp · LXL04_032681|LXL04_032681|OH1004|CDS

ATGATCAGTGCGTCCAACCCTAATTCAATGATGTCTTCGTCGTCAACAACAGGCAATAACAACGCTGCCGGCAGCGGCCAACAAGCGCCGGGTTTGAAGACGTATTTCAAAACTCCGGAAGGAAGGTATAAGCTTAAGTACGAGAAAAGTCATCCCGCCGGTCTCCTTCACTACGCCCATGGCAAATCTGTTACCCAGGTGACTCTGGCTCATCTTAAGGATAAACCTGCACATGCTCTATCATCTTCATCTTCAAGTAT...

Protein

Download Protein FASTA

548 aa · LXL04_032681|LXL04_032681|OH1004|PROTEIN

MISASNPNSMMSSSSTTGNNNAAGSGQQAPGLKTYFKTPEGRYKLKYEKSHPAGLLHYAHGKSVTQVTLAHLKDKPAHALSSSSSSIGISSGVKSAAAKLLGGGNGSRALSFVGGNGGSKSSSGTTKVGSLSSSYTNSYTPNSNFDGKGTYLIFNVGDAIFISDLNSQDKDPIKSINFSTSNPISHAFDPDAKDGHDLLIGLNCGDVSLRQQLQDGGKKLVGGQHYNKDGCVNNSRCTSIAWVPNGDGTFVVAHADGNMY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032681`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_032681`
Location	Chr07:27760349-27764219 (-)
Description	Similar to creC: Catabolite repression protein creC (Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032681` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0045013 carbon catabolite repression of transcription Biological Process GO:0090263 positive regulation of canonical Wnt signaling pathway Biological Process GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0032153 cell division site Cellular Component GO:0051286 cell tip Cellular Component GO:0035800 deubiquitinase activator activity Molecular Function
KEGG gene cross-reference	act:ACLA_082740 ang:An11g02750 hsa:91833 nfi:NFIA_053550 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.540

Rank 1 · LXL04_032681 · OH-1004

Nucleus0.358

Rank 2 · LXL04_032681 · OH-1004

Lysosome / Vacuole0.146

Rank 3 · LXL04_032681 · OH-1004

Cell membrane0.121

Rank 4 · LXL04_032681 · OH-1004

Golgi apparatus0.088

Rank 5 · LXL04_032681 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23381.2Beta-prop_IFT122_1st234-391 aa

PF25173.2Beta-prop_WDR3_1st289-428 aa

PF24796.2WDR55290-391 aa

PF24814.2WD40_Prp19294-391 aa

PF23414.2Beta-prop_EML_2295-391 aa

PF25168.2Beta-prop_WDR36-Utp21_2nd295-377 aa

PF25047.1Beta-prop_TEP1_2nd296-389 aa

PF00400.39WD40298-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032681	`PF23381.2`	Beta-prop_IFT122_1st	234	391	5e-23	82.5
LXL04_032681	`PF25173.2`	Beta-prop_WDR3_1st	289	428	2.1e-12	47.8
LXL04_032681	`PF24796.2`	WDR55	290	391	2.1e-08	34.3
LXL04_032681	`PF24814.2`	WD40_Prp19	294	391	7.7e-11	42.3
LXL04_032681	`PF23414.2`	Beta-prop_EML_2	295	391	2.5e-10	40.9
LXL04_032681	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	295	377	5.9e-06	26.5
LXL04_032681	`PF25047.1`	Beta-prop_TEP1_2nd	296	389	1.4e-10	41.5
LXL04_032681	`PF00400.39`	WD40	298	326	2.6e-10	41.1
LXL04_032681	`PF23381.2`	Beta-prop_IFT122_1st	299	391	5e-23	82.5
LXL04_032681	`PF24780.2`	WD40_MABP1-WDR62_1st	299	391	6.2e-06	26.4
LXL04_032681	`PF25175.2`	Beta-prop_WDR5	300	391	1.1e-14	55.2
LXL04_032681	`PF00400.39`	WD40	343	368	2.6e-10	41.1
LXL04_032681	`PF25174.2`	Beta-prop_THOC3	345	425	2.3e-13	50.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card