RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG061760
Reference: TK1151 Chr: ChrUn Coordinates: 17912030-17914062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1455 bp · TkAUNG061760|TK1151|cDNA

ATGAGCAACCAACAGGATCTTTCTTCCTGCTCTCATGTTCTTCCTATCCTAAATTCCGTCCATCATACGGAATTGATGAAATTGGAATTGAATTCAGAGCCCTTAAGGGATTGGAAATTTCAGTCGGATTGGTACTCTCCAACTCGCCTCCATAGCAGCCCCGTCGAATATGATTTTCCGGGCGATCGCTTCATACCCAACAGGAGTTTGATGGATCTTGATCAAGCCTACACCCTGTTGACTAACCCAACCAATCTTCC...

CDS

Download CDS FASTA

1455 bp · TkAUNG061760|TK1151|CDS

ATGAGCAACCAACAGGATCTTTCTTCCTGCTCTCATGTTCTTCCTATCCTAAATTCCGTCCATCATACGGAATTGATGAAATTGGAATTGAATTCAGAGCCCTTAAGGGATTGGAAATTTCAGTCGGATTGGTACTCTCCAACTCGCCTCCATAGCAGCCCCGTCGAATATGATTTTCCGGGCGATCGCTTCATACCCAACAGGAGTTTGATGGATCTTGATCAAGCCTACACCCTGTTGACTAACCCAACCAATCTTCC...

Protein

Download Protein FASTA

484 aa · TkAUNG061760|TK1151|PROTEIN

MSNQQDLSSCSHVLPILNSVHHTELMKLELNSEPLRDWKFQSDWYSPTRLHSSPVEYDFPGDRFIPNRSLMDLDQAYTLLTNPTNLPTRCNFSAEYRRIMEGSLTLDSEGRPFRLLVFRGSPKSSRKSIRYIDEIRRSDEENFNHNNTPNQQRKLPKKETRILDAPEIRDDFYKNIMDWGKNNILAIALGRELYLWNAANEDLHHIFKPTTVDDDPSSVSWSQDGKKLAVGHSSSKILLWDVDTGKLIRRLEGHHAMVGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG061760
TK1151 IDTkAUNG061760
OH-1004 IDLXL04_025521
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)43.200
Protein coverage (%)TK1151 83.678 / OH-1004 87.692
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG061760
LocationChrUn:17912030-17914062 (+)
DescriptionSimilar to CDC20-1: Cell division cycle 20.1, cofactor of APC complex
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g27570 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release
At5g26900 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release
At5g27080 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release
At4g33260 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release
At4g33270 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025521 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0016567 protein ubiquitination Biological Process
GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process
GO:0051301 cell division Biological Process
GO:1905786 positive regulation of anaphase-promoting complex-dependent catabolic process Biological Process
GO:0005634 nucleus Cellular Component
GO:0005680 anaphase-promoting complex Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0033597 mitotic checkpoint complex Cellular Component
GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component
GO:0010997 anaphase-promoting complex binding Molecular Function
GO:0019900 kinase binding Molecular Function
GO:1990757 ubiquitin ligase activator activity Molecular Function
KEGG gene cross-reference
ath:AT4G33260
ath:AT4G33270
ath:AT5G26900
ath:AT5G27080
ath:AT5G27570
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.496
Rank 1 · TkAUNG061760 · TK1151
Cytoplasm0.466
Rank 2 · TkAUNG061760 · TK1151
Lysosome / Vacuole0.052
Rank 3 · TkAUNG061760 · TK1151
Cell membrane0.048
Rank 4 · TkAUNG061760 · TK1151
Golgi apparatus0.034
Rank 5 · TkAUNG061760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23798Beta-prop_SPT8135-233 aa
PF24807WD40_CDC20-Fz163-460 aa
PF23383Beta-prop_IFT140_1st171-247 aa
PF24817WD40_WDHD1_1st176-264 aa
PF23389Beta-prop_WDR19_1st177-272 aa
PF23609Beta-prop_EIPR1182-370 aa
PF16755Beta-prop_NUP159_NUP214182-246 aa
PF25168Beta-prop_WDR36-Utp21_2nd183-327 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG061760PF23798Beta-prop_SPT81352330.009115.6
TkAUNG061760PF24807WD40_CDC20-Fz1634602.4e-109365.9
TkAUNG061760PF23383Beta-prop_IFT140_1st1712477.5e-1038.8
TkAUNG061760PF24817WD40_WDHD1_1st1762643.1e-2589.7
TkAUNG061760PF23389Beta-prop_WDR19_1st1772725.8e-1142.7
TkAUNG061760PF23609Beta-prop_EIPR11823700.0004420.5
TkAUNG061760PF16755Beta-prop_NUP159_NUP2141822460.03714.0
TkAUNG061760PF25168Beta-prop_WDR36-Utp21_2nd1833271e-1145.4
TkAUNG061760PF24506KNTC1_N1832470.1512.0
TkAUNG061760PF25173Beta-prop_WDR3_1st1862731.9e-28100.1
TkAUNG061760PF24780WD40_MABP1-WDR62_1st1873196.1e-0729.8
TkAUNG061760PF25171Beta-prop_WDR36-Utp21_1st1883226.4e-0936.3
TkAUNG061760PF25174Beta-prop_THOC31903407.5e-41140.6
TkAUNG061760PF25175Beta-prop_WDR51913251.2e-33117.4
TkAUNG061760PF24796WDR551922719.6e-1555.1
TkAUNG061760PF25391WD40_Gbeta1923719.1e-1142.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q3E906Arabidopsis thalianasp|Q3E906|CD205_ARATH Cell division cycle 20.5, cofactor of APC complex44.100%Swiss-ProtMedium
Q4PSE4Arabidopsis thalianasp|Q4PSE4|CDC24_ARATH Cell division cycle 20.4, cofactor of APC complex42.800%Swiss-ProtMedium
Q9S7H3Arabidopsis thalianasp|Q9S7H3|CD203_ARATH Cell division cycle 20.3, cofactor of APC complex42.900%Swiss-ProtMedium
Q9S7I8Arabidopsis thalianasp|Q9S7I8|CDC22_ARATH Cell division cycle 20.2, cofactor of APC complex42.000%Swiss-ProtMedium
Q9SZA4Arabidopsis thalianasp|Q9SZA4|CDC21_ARATH Cell division cycle 20.1, cofactor of APC complex41.300%Swiss-ProtMedium

JBrowse

View in Genome Browser