LXL04_025521 | RubberDandelionOmics

Gene overview

LXL04_025521

Reference: OH-1004 Chr: Chr05 Coordinates: 112910938-112912572 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1368 bp · LXL04_025521|LXL04_025521|OH1004|cDNA

ATGGATGCAGGATCTGTAAGTTCTTCGGCTACCAAGTCACACTCACGATGCCCCCTTAAGGAGCAATTCCTTCAAAGAAAAAACTCCCGAGAAAACTTGGATAGATTCATACCAAACAGATCAGCCATGGATTTCGATTACGCTCATTACATGCTTACGGAAGCCAAAAAAGGTAACGAAAATCTAACAGCGAGCTCACCGTCAAAGGAAGCATACAGGAAGCATTTAGCAGATAGCTTCAACATGAACCGCACAAGGAT...

CDS

Download CDS FASTA

1368 bp · LXL04_025521|LXL04_025521|OH1004|CDS

ATGGATGCAGGATCTGTAAGTTCTTCGGCTACCAAGTCACACTCACGATGCCCCCTTAAGGAGCAATTCCTTCAAAGAAAAAACTCCCGAGAAAACTTGGATAGATTCATACCAAACAGATCAGCCATGGATTTCGATTACGCTCATTACATGCTTACGGAAGCCAAAAAAGGTAACGAAAATCTAACAGCGAGCTCACCGTCAAAGGAAGCATACAGGAAGCATTTAGCAGATAGCTTCAACATGAACCGCACAAGGAT...

Protein

Download Protein FASTA

455 aa · LXL04_025521|LXL04_025521|OH1004|PROTEIN

MDAGSVSSSATKSHSRCPLKEQFLQRKNSRENLDRFIPNRSAMDFDYAHYMLTEAKKGNENLTASSPSKEAYRKHLADSFNMNRTRILAFKNKPPTPTDAIPNECSTSFQQSKPVKARRNIPQTSERTLDAPEILDDYYLNLLDWGSSNVLAIALSNTVYLWDATDGNTSELVTVDDESGPVTSVKWAPDGRHISIGLNNSDIQLWDSTSNRLLRTLKGGHQSRVGSLDWNNHILTTGGMDGRIVNNDVRIRSHIIETYT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025521`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025521

Location Chr05:112910938-112912572 (+)

Description Similar to CDC20-1: Cell division cycle 20.1, cofactor of APC complex

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33270`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release
`At4g33260`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release
`At5g27570`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release
`At5g26900`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release
`At5g27080`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025521 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0051301 cell division Biological Process

GO:1905786 positive regulation of anaphase-promoting complex-dependent catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005680 anaphase-promoting complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0033597 mitotic checkpoint complex Cellular Component

GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component

GO:0010997 anaphase-promoting complex binding Molecular Function

GO:0019900 kinase binding Molecular Function

GO:1990757 ubiquitin ligase activator activity Molecular Function

KEGG gene cross-reference

ath:AT4G33260

ath:AT4G33270

ath:AT5G26900

ath:AT5G27080

ath:AT5G27570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.529

Rank 1 · LXL04_025521 · OH-1004

Cytoplasm0.417

Rank 2 · LXL04_025521 · OH-1004

Cell membrane0.061

Rank 3 · LXL04_025521 · OH-1004

Lysosome / Vacuole0.051

Rank 4 · LXL04_025521 · OH-1004

Golgi apparatus0.041

Rank 5 · LXL04_025521 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24807.2WD40_CDC20-Fz129-426 aa

PF24817.2WD40_WDHD1_1st140-232 aa

PF23389.2Beta-prop_WDR19_1st143-244 aa

PF23381.2Beta-prop_IFT122_1st149-293 aa

PF23414.2Beta-prop_EML_2149-232 aa

PF24796.2WDR55149-257 aa

PF25168.2Beta-prop_WDR36-Utp21_2nd149-286 aa

PF25171.2Beta-prop_WDR36-Utp21_1st149-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025521	`PF24807.2`	WD40_CDC20-Fz	129	426	2.5e-124	415.0
LXL04_025521	`PF24817.2`	WD40_WDHD1_1st	140	232	1e-23	84.7
LXL04_025521	`PF23389.2`	Beta-prop_WDR19_1st	143	244	1.4e-14	54.6
LXL04_025521	`PF23381.2`	Beta-prop_IFT122_1st	149	293	4.1e-37	128.7
LXL04_025521	`PF23414.2`	Beta-prop_EML_2	149	232	3.4e-21	76.5
LXL04_025521	`PF24796.2`	WDR55	149	257	6e-16	59.1
LXL04_025521	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	149	286	3.5e-12	47.0
LXL04_025521	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	149	230	6.8e-11	42.8
LXL04_025521	`PF25391.2`	WD40_Gbeta	150	292	1e-12	48.5
LXL04_025521	`PF23609.2`	Beta-prop_EIPR1	150	341	4.9e-07	30.2
LXL04_025521	`PF25173.2`	Beta-prop_WDR3_1st	151	250	4.8e-37	128.2
LXL04_025521	`PF25047.1`	Beta-prop_TEP1_2nd	151	269	1.8e-15	57.6
LXL04_025521	`PF25174.2`	Beta-prop_THOC3	152	292	6.4e-43	147.4
LXL04_025521	`PF24814.2`	WD40_Prp19	152	229	1e-29	104.2
LXL04_025521	`PF25175.2`	Beta-prop_WDR5	154	223	4.5e-34	118.8
LXL04_025521	`PF23383.2`	Beta-prop_IFT140_1st	166	246	7.3e-10	38.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZA4`	Arabidopsis thaliana	Cell division cycle 20.1, cofactor of APC complex	77.948%	Swiss-Prot	strong database homology
`Q9S7I8`	Arabidopsis thaliana	Cell division cycle 20.2, cofactor of APC complex	79.412%	Swiss-Prot	strong database homology
`Q3E906`	Arabidopsis thaliana	Cell division cycle 20.5, cofactor of APC complex	69.111%	Swiss-Prot	strong database homology
`Q4PSE4`	Arabidopsis thaliana	Cell division cycle 20.4, cofactor of APC complex	66.743%	Swiss-Prot	strong database homology
`Q9S7H3`	Arabidopsis thaliana	Cell division cycle 20.3, cofactor of APC complex	66.591%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card