TkAUNG055110 | RubberDandelionOmics

Gene overview

TkAUNG055110

Reference: TK1151 Chr: ChrUn Coordinates: 15695512-15697396 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1357 bp · TkAUNG055110|TK1151|cDNA

CTGCATTTACAGAGAAAAGGGTCGTAGTCTGTGAAGTGTGCGAGAAAGGAAATCGAAGAATCAATGGAAAGGGGACGAATGTATGACGAAATGGGAGAGATAAAGAAAGGGCCATGGAAGGCCGAAGAAGATGAAGTTTTGATGAAGCATGTCAAGAAATACGGACCCAGAGATTGGAGCTCCATTCGATCCAAAGGCCTTCTTCAACGCACTGGAAAATCTTGTCGTCTTCGTTGGGTCAACAAACTTAGACCCAATCT...

CDS

Download CDS FASTA

1005 bp · TkAUNG055110|TK1151|CDS

ATGGAAAGGGGACGAATGTATGACGAAATGGGAGAGATAAAGAAAGGGCCATGGAAGGCCGAAGAAGATGAAGTTTTGATGAAGCATGTCAAGAAATACGGACCCAGAGATTGGAGCTCCATTCGATCCAAAGGCCTTCTTCAACGCACTGGAAAATCTTGTCGTCTTCGTTGGGTCAACAAACTTAGACCCAATCTCAAAAATGGTGTGAAGTTTTCTTCAGAGGAGGAGCGGACAGTGATAGAACTACAGGGGCAATT...

Protein

Download Protein FASTA

334 aa · TkAUNG055110|TK1151|PROTEIN

MERGRMYDEMGEIKKGPWKAEEDEVLMKHVKKYGPRDWSSIRSKGLLQRTGKSCRLRWVNKLRPNLKNGVKFSSEEERTVIELQGQFGNKWARIATYLPGRTDNDVKNFWSSRQKRLARVLQTSPPPPPPKSYKSLRESPALHKVPTFEAPKQSSSTEESSVTSPKTMSCSSPYCEPIKMVPLPELINPTTATANANATATTTTTTTTVPTNFLAYDDIQPLCQYPPHQLLLPFPHGPHLKIELPQPPPLPLLDNQDIFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG055110`
TK1151 ID	TkAUNG055110
OH-1004 ID	LXL04_038186
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.400
Protein coverage (%)	TK1151 32.335 / OH-1004 22.107 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG055110

Location ChrUn:15695512-15697396 (-)

Description Similar to MYB101: Transcription factor MYB101

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60460`	Transcription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression.	Male germ line development in Arabidopsis. duo pollen mutants reveal gametophytic regulators of generative cell cycle progression.2005 · DOI: 10.1104/pp.104.053165 A novel class of MYB factors controls sperm-cell formation in plants.2005 · DOI: 10.1016/j.cub.2005.01.013 A plant germline-specific integrator of sperm specification and cell cycle progression.2009 · DOI: 10.1371/journal.pgen.1000430 The R2R3 MYB transcription factor DUO1 activates a male germline-specific regulon essential for sperm cell differentiation in Arabidopsis.2011 · DOI: 10.1105/tpc.110.081059 An EAR-Dependent Regulatory Module Promotes Male Germ Cell Division and Sperm Fertility in Arabidopsis.2014 · DOI: 10.1105/tpc.114.124743
`At4g26930`	Transcription activator.	MYB97, MYB101 and MYB120 function as male factors that control pollen tube-synergid interaction in Arabidopsis thaliana fertilization.2013 · DOI: 10.1371/journal.pgen.1003933

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0549500`	Probable transcription factor.	No verified direct reference in this release
`UniProt: A2WW87`	Transcriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells.	No verified direct reference in this release
`Os01g0812000`	Transcriptional activator of gibberellin-dependent alpha- amylase expression in aleurone cells.	Loss-of-function mutations of the rice GAMYB gene impair alpha-amylase expression in aleurone and flower development.2004 · DOI: 10.1105/tpc.017327 Gibberellin modulates anther development in rice via the transcriptional regulation of GAMYB.2009 · DOI: 10.1105/tpc.108.062935 Identification of gamyb-4 and analysis of the regulatory role of GAMYB in rice anther development.2010 · DOI: 10.1111/j.1744-7909.2010.00959.x Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals.2012 · DOI: 10.1105/tpc.112.097741

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038186 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009555 pollen development Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0030154 cell differentiation Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

KEGG gene cross-reference

ath:AT2G32460

ath:AT4G26930

ath:AT5G06100

dosa:Os01g0812000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · TkAUNG055110 · TK1151

Cytoplasm0.136

Rank 2 · TkAUNG055110 · TK1151

Cell membrane0.020

Rank 3 · TkAUNG055110 · TK1151

Mitochondrion0.015

Rank 4 · TkAUNG055110 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkAUNG055110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_714-61 aa

PF00249Myb_DNA-binding15-60 aa

PF13921Myb_DNA-bind_618-69 aa

PF00249Myb_DNA-binding71-111 aa

PF13921Myb_DNA-bind_672-112 aa

PF15963Myb_DNA-bind_773-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG055110	`PF15963`	Myb_DNA-bind_7	14	61	0.2	12.2
TkAUNG055110	`PF00249`	Myb_DNA-binding	15	60	1.4e-27	96.3
TkAUNG055110	`PF13921`	Myb_DNA-bind_6	18	69	1.3e-19	70.8
TkAUNG055110	`PF00249`	Myb_DNA-binding	71	111	1.4e-27	96.3
TkAUNG055110	`PF13921`	Myb_DNA-bind_6	72	112	1.3e-19	70.8
TkAUNG055110	`PF15963`	Myb_DNA-bind_7	73	117	0.2	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A178VEK7`	Arabidopsis thaliana	sp\|A0A178VEK7\|DUO1_ARATH Transcription factor DUO1	45.800%	Swiss-Prot	Medium
`Q9S773`	Arabidopsis thaliana	sp\|Q9S773\|MYB97_ARATH Transcription factor MYB97	57.000%	Swiss-Prot	Low
`Q0JB89`	Oryza sativa subsp. japonica	sp\|Q0JB89\|MYB58_ORYSJ Probable transcription factor MYB58	81.800%	Swiss-Prot	Low
`A2WW87`	Oryza sativa subsp. indica	sp\|A2WW87\|GAM1_ORYSI Transcription factor GAMYB	54.600%	Swiss-Prot	Low
`Q0JIC2`	Oryza sativa subsp. japonica	sp\|Q0JIC2\|GAMYB_ORYSJ Transcription factor GAMYB	54.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card