TkAUNG053450 | RubberDandelionOmics

Gene overview

TkAUNG053450

Reference: TK1151 Chr: ChrUn Coordinates: 15283811-15286549 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2274 bp · TkAUNG053450|TK1151|cDNA

CCTCCCTCTGCTCGCACCTACCAAAACGTACCCAACGTCTTATATCTAAGTCAACTTTGAAAAACAATAAAGTCAAATCAAGCAATTACAAAGCAACTTGTCTGGAATCAATGCTTCTAGTTTCACCTTTACATCTTCTTGATCACAAATCATTAAGTTATTGCTATGGAAGATACCCATGTCGACAAAACTTTGCAAACACAACCATGTCTCCAATTTTCCCTTTCGGAGCTTCAGATTGCCACCCATCGATTTGATGA...

CDS

Download CDS FASTA

1941 bp · TkAUNG053450|TK1151|CDS

ATGGAAGATACCCATGTCGACAAAACTTTGCAAACACAACCATGTCTCCAATTTTCCCTTTCGGAGCTTCAGATTGCCACCCATCGATTTGATGAGGGTTCCGTCATAGGTCAAGGTGGTTATGGAAAGGTTTATAAAGGTTCAGTCAAGATTGGAGAAACTTATGTTCTTGTTGCCATCAAACGATTGCACTCAAATTCTAGTCAAGGTGCCTCGGAATTTTGGGCTGAAGTTGAGATGCTCTCAAAACTGAGGCACTG...

Protein

Download Protein FASTA

646 aa · TkAUNG053450|TK1151|PROTEIN

MEDTHVDKTLQTQPCLQFSLSELQIATHRFDEGSVIGQGGYGKVYKGSVKIGETYVLVAIKRLHSNSSQGASEFWAEVEMLSKLRHCNLASLIGYCDHGKEMMLVYEYMPNGTLEACFFKGVTPLSWLLRLNICIGAARGLDYLHTGTGTKQAVIHRDVKTSNILLDANYAAKISDFGLAKVGPTNTPVTTGVKGTFGYLDPTYFLTKKLTTKSDVYAFGVVLLEVLCGRPAVDTTLKEEQRGLAKWGQDRIKEGKVFKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG053450`
TK1151 ID	TkAUNG053450
OH-1004 ID	LXL04_017085
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.800
Protein coverage (%)	TK1151 97.678 / OH-1004 91.189 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG053450

Location ChrUn:15283811-15286549 (+)

Description Similar to BAK1: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017085 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005768 endosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G33430

dosa:Os08g0174700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.656

Rank 1 · TkAUNG053450 · TK1151

Cytoplasm0.261

Rank 2 · TkAUNG053450 · TK1151

Nucleus0.193

Rank 3 · TkAUNG053450 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkAUNG053450 · TK1151

Golgi apparatus0.030

Rank 5 · TkAUNG053450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase31-300 aa

PF07714PK_Tyr_Ser-Thr34-302 aa

PF07387Seadorna_VP7137-176 aa

PF01636APH151-184 aa

PF12330Haspin_kinase155-183 aa

PF04286DUF445209-312 aa

PF07714PK_Tyr_Ser-Thr409-640 aa

PF00069Pkinase410-639 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG053450	`PF00069`	Pkinase	31	300	4.4e-65	220.4
TkAUNG053450	`PF07714`	PK_Tyr_Ser-Thr	34	302	1.7e-68	231.5
TkAUNG053450	`PF07387`	Seadorna_VP7	137	176	0.034	13.9
TkAUNG053450	`PF01636`	APH	151	184	0.25	11.8
TkAUNG053450	`PF12330`	Haspin_kinase	155	183	0.15	11.8
TkAUNG053450	`PF04286`	DUF445	209	312	0.2	12.3
TkAUNG053450	`PF07714`	PK_Tyr_Ser-Thr	409	640	1.7e-68	231.5
TkAUNG053450	`PF00069`	Pkinase	410	639	4.4e-65	220.4
TkAUNG053450	`PF12330`	Haspin_kinase	476	526	0.15	11.8
TkAUNG053450	`PF07387`	Seadorna_VP7	480	515	0.034	13.9
TkAUNG053450	`PF01636`	APH	497	519	0.25	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	55.400%	Swiss-Prot	Low
`Q9SCZ4`	Arabidopsis thaliana	sp\|Q9SCZ4\|FERON_ARATH Receptor-like protein kinase FERONIA	53.800%	Swiss-Prot	Low
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	53.400%	Swiss-Prot	Low
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	52.500%	Swiss-Prot	Low
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	52.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card