TkAUNG048850 | RubberDandelionOmics

Gene overview

TkAUNG048850

Reference: TK1151 Chr: ChrUn Coordinates: 13513802-13514987 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

513 bp · TkAUNG048850|TK1151|cDNA

TGCTCCAACATCGCCGCTGCTCCATCTCGGCGCTGCTCCATCTCGCCACTGCTACACCCTTCCTTCTCGACCGGCGACGCAGCAGCCCTTCCTTCTCCAAGCTCCGATTACAGAGCAGTCTTCTCCCCGATTTCGCTGCTCCATCAGTCTTCTCCAAGCTACAATAACAGAAGGTATGCATCAAGGGTACGTTCCATAGTGAATGATCCTAGCAAGAATGTGTCATCAAAAGAAGTGGCAAGATTAAAGAAGCTATTGGC...

CDS

Download CDS FASTA

513 bp · TkAUNG048850|TK1151|CDS

TGCTCCAACATCGCCGCTGCTCCATCTCGGCGCTGCTCCATCTCGCCACTGCTACACCCTTCCTTCTCGACCGGCGACGCAGCAGCCCTTCCTTCTCCAAGCTCCGATTACAGAGCAGTCTTCTCCCCGATTTCGCTGCTCCATCAGTCTTCTCCAAGCTACAATAACAGAAGGTATGCATCAAGGGTACGTTCCATAGTGAATGATCCTAGCAAGAATGTGTCATCAAAAGAAGTGGCAAGATTAAAGAAGCTATTGGC...

Protein

Download Protein FASTA

170 aa · TkAUNG048850|TK1151|PROTEIN

CSNIAAAPSRRCSISPLLHPSFSTGDAAALPSPSSDYRAVFSPISLLHQSSPSYNNRRYASRVRSIVNDPSKNVSSKEVARLKKLLAYWKEQAGKRGDDEELVEIQDERPSKGKGDNSHSILLQQSADVKKQTVFFLQTADVWSTSSAAEACRCGPQTADVLASKKQTAP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG048850`
TK1151 ID	TkAUNG048850
OH-1004 ID	LXL04_013931
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.700
Protein coverage (%)	TK1151 40.000 / OH-1004 5.359 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG048850

Location ChrUn:13513802-13514987 (-)

Description Similar to KIN14E: Kinesin-like protein KIN-14E

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65930`	Minus-end microtubule-dependent motor protein involved in the regulation of cell division and trichome morphogenesis through microtubules bundling.	Bundling of microtubules by motor and tail domains of a kinesin-like calmodulin-binding protein from Arabidopsis: regulation by Ca(2+)/Calmodulin.2000 · DOI: 10.1006/bbrc.1999.1896 KIC, a novel Ca2+ binding protein with one EF-hand motif, interacts with a microtubule motor protein and regulates trichome morphogenesis.2004 · DOI: 10.1105/tpc.016600 Analysis of calcium/calmodulin regulation of a plant kinesin using co-sedimentation and ATPase assays.2007 · DOI: 10.1007/978-1-59745-490-2_2 PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390 A novel plant calmodulin-binding protein with a kinesin heavy chain motor domain.1996 · DOI: 10.1074/jbc.271.12.7052 In vitro motility of AtKCBP, a calmodulin-binding kinesin protein of Arabidopsis.1997 · DOI: 10.1073/pnas.94.1.322 Interaction of Arabidopsis kinesin-like calmodulin-binding protein with tubulin subunits: modulation by Ca(2+)-calmodulin.1997 · DOI: 10.1046/j.1365-313x.1997.12051139.x Characterization of microtubule binding domains in the Arabidopsis kinesin-like calmodulin binding protein.1998 · DOI: 10.1105/tpc.10.6.957 Ca2+/calmodulin regulation of the Arabidopsis kinesin-like calmodulin-binding protein.1998 · DOI: 10.1002/(sici)1097-0169(1998)40:4<408::aid-cm8>3.0.co;2-6

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0666900`	Minus-end microtubule-dependent motor protein involved in the regulation of cell division.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013931 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001578 microtubule bundle formation Biological Process

GO:0007017 microtubule-based process Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0010091 trichome branching Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0048629 trichome patterning Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009524 phragmoplast Cellular Component

KEGG gene cross-reference

ath:AT2G47500

ath:AT5G27000

ath:AT5G65930

dosa:Os03g0114000

dosa:Os04g0666900

osa:4337322

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.396

Rank 1 · TkAUNG048850 · TK1151

Cytoplasm0.289

Rank 2 · TkAUNG048850 · TK1151

Plastid0.173

Rank 3 · TkAUNG048850 · TK1151

Cell membrane0.125

Rank 4 · TkAUNG048850 · TK1151

Endoplasmic reticulum0.103

Rank 5 · TkAUNG048850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18029Glyoxalase_680-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG048850	`PF18029`	Glyoxalase_6	80	151	0.21	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHN8`	Arabidopsis thaliana	sp\|Q9FHN8\|KN14E_ARATH Kinesin-like protein KIN-14E	64.100%	Swiss-Prot	Low
`Q7XPJ0`	Oryza sativa subsp. japonica	sp\|Q7XPJ0\|KN14I_ORYSJ Kinesin-like protein KIN-14I	67.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card