LXL04_013931 | RubberDandelionOmics

Gene overview

LXL04_013931

Reference: OH-1004 Chr: Chr03 Coordinates: 38318822-38324885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3810 bp · LXL04_013931|LXL04_013931|OH1004|cDNA

ATGGCTTCCGATGCACCATCAATAATGGCTCAAAGTGTGAGAACAAGCAGATCTTCATTCAGCTCAAGCAATGGATATGAAACTCAATCTCACTATTCCGCCATTACAAACGGAGATGACTATGACAGCGATGGTTCAAATTTTGCACCACCTACGCCAATGACCCTCTCCAATTCCATTCCAGCCGAGCTTGCTGGTGCAATTCCCCTAATCGACAAATTCCAAGTAGAGGGTTTTCTAAGGTCCATGCAAAAACAAAT...

CDS

Download CDS FASTA

3810 bp · LXL04_013931|LXL04_013931|OH1004|CDS

ATGGCTTCCGATGCACCATCAATAATGGCTCAAAGTGTGAGAACAAGCAGATCTTCATTCAGCTCAAGCAATGGATATGAAACTCAATCTCACTATTCCGCCATTACAAACGGAGATGACTATGACAGCGATGGTTCAAATTTTGCACCACCTACGCCAATGACCCTCTCCAATTCCATTCCAGCCGAGCTTGCTGGTGCAATTCCCCTAATCGACAAATTCCAAGTAGAGGGTTTTCTAAGGTCCATGCAAAAACAAAT...

Protein

Download Protein FASTA

1269 aa · LXL04_013931|LXL04_013931|OH1004|PROTEIN

MASDAPSIMAQSVRTSRSSFSSSNGYETQSHYSAITNGDDYDSDGSNFAPPTPMTLSNSIPAELAGAIPLIDKFQVEGFLRSMQKQINSAGKRGFFSKRSVGPQDREKFTFEDMLCFQKDPIPTSLLKINGDLVSRAVKLFQTILKYTGIDSSEKGNQIGIEDRIELVGKLFKQALKRSELRDELFAQISKQTRNCPDRQHLIRAWELMYLCASCMPPSKDIGGYLSEYIHDVAHNSNTDPDVQVYALNTLNALKCSVKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013931`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013931

Location Chr03:38318822-38324885 (-)

Description Similar to KIN14E: Kinesin-like protein KIN-14E

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65930`	Minus-end microtubule-dependent motor protein involved in the regulation of cell division and trichome morphogenesis through microtubules bundling.	Bundling of microtubules by motor and tail domains of a kinesin-like calmodulin-binding protein from Arabidopsis: regulation by Ca(2+)/Calmodulin.2000 · DOI: 10.1006/bbrc.1999.1896 KIC, a novel Ca2+ binding protein with one EF-hand motif, interacts with a microtubule motor protein and regulates trichome morphogenesis.2004 · DOI: 10.1105/tpc.016600 Analysis of calcium/calmodulin regulation of a plant kinesin using co-sedimentation and ATPase assays.2007 · DOI: 10.1007/978-1-59745-490-2_2 PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390 A novel plant calmodulin-binding protein with a kinesin heavy chain motor domain.1996 · DOI: 10.1074/jbc.271.12.7052 In vitro motility of AtKCBP, a calmodulin-binding kinesin protein of Arabidopsis.1997 · DOI: 10.1073/pnas.94.1.322 Interaction of Arabidopsis kinesin-like calmodulin-binding protein with tubulin subunits: modulation by Ca(2+)-calmodulin.1997 · DOI: 10.1046/j.1365-313x.1997.12051139.x Characterization of microtubule binding domains in the Arabidopsis kinesin-like calmodulin binding protein.1998 · DOI: 10.1105/tpc.10.6.957 Ca2+/calmodulin regulation of the Arabidopsis kinesin-like calmodulin-binding protein.1998 · DOI: 10.1002/(sici)1097-0169(1998)40:4<408::aid-cm8>3.0.co;2-6
`At5g27000`	Microtubule-binding motor protein.	No verified direct reference in this release
`At2g47500`	Kinesin-like protein KIN-14I.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0666900`	Minus-end microtubule-dependent motor protein involved in the regulation of cell division.	No verified direct reference in this release
`Os03g0114000`	Kinesin-like protein KIN-14E.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013931 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001578 microtubule bundle formation Biological Process

GO:0007017 microtubule-based process Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0010091 trichome branching Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0048629 trichome patterning Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009524 phragmoplast Cellular Component

KEGG gene cross-reference

ath:AT2G47500

ath:AT5G27000

ath:AT5G65930

dosa:Os03g0114000

dosa:Os04g0666900

osa:4337322

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.651

Rank 1 · LXL04_013931 · OH-1004

Cell membrane0.296

Rank 2 · LXL04_013931 · OH-1004

Nucleus0.176

Rank 3 · LXL04_013931 · OH-1004

Golgi apparatus0.090

Rank 4 · LXL04_013931 · OH-1004

Lysosome / Vacuole0.043

Rank 5 · LXL04_013931 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00784.23MyTH4170-274 aa

PF21989.3RA_2279-381 aa

PF00373.24FERM_M386-501 aa

PF02174.24IRS512-588 aa

PF16796.12Microtub_bd874-1032 aa

PF00225.30Kinesin899-1214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013931	`PF00784.23`	MyTH4	170	274	6.4e-28	97.9
LXL04_013931	`PF21989.3`	RA_2	279	381	1.3e-06	29.1
LXL04_013931	`PF00373.24`	FERM_M	386	501	1.6e-21	77.5
LXL04_013931	`PF02174.24`	IRS	512	588	3e-07	31.1
LXL04_013931	`PF16796.12`	Microtub_bd	874	1032	1.7e-44	152.2
LXL04_013931	`PF00225.30`	Kinesin	899	1214	5.3e-109	364.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHN8`	Arabidopsis thaliana	Kinesin-like protein KIN-14E	72.168%	Swiss-Prot	strong database homology
`O81635`	Arabidopsis thaliana	Kinesin-like protein KIN-14G	41.960%	Swiss-Prot	weak database homology
`F4IL57`	Arabidopsis thaliana	Kinesin-like protein KIN-14I	39.651%	Swiss-Prot	weak database homology
`Q7XPJ0`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-14I	71.832%	Swiss-Prot	strong database homology
`B9FAF3`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-14E	36.466%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card