TkAUNG044520 | RubberDandelionOmics

Gene overview

TkAUNG044520

Reference: TK1151 Chr: ChrUn Coordinates: 12381453-12385538 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2357 bp · TkAUNG044520|TK1151|cDNA

ACCCTGGAACACGAGAATGGTGGCAAAGAAGGACAGAGGGTCGAGCTGCCATTTCTGGTAACAATATCAGGTGGGCCATACCCATCCATTACCCGTTTCTCTAGGGTTTTGTGATCTTCAACTCTTCAGTATAATAGAGCCAAGATAATTAATCACACAAGCAATGCAAAATATCCATGTATTCAACTGATCTTCTGTTCACTACTATTCTCCTTTCTCCCTAATTTGCAAAGAAACATCACATACTTCTATTTTGGTTT...

CDS

Download CDS FASTA

1767 bp · TkAUNG044520|TK1151|CDS

ATGGGCGTTGATGACAAAACTCTCAAGTTATCCAGTGATGGTATGACTATAACTCGCCAAGAATGGCCCATGTCCCTGCACGCCTATTCAGATCTCACCAATGTTTCTCCAGTAGTCTTCTTATATCTTCTGAAAGAATGTTATCTTTATGGCACATGCAAGGCAACTGCAAAGTTTTTTTCCCTCCAACATCAAGTCCTTCAAGCTTTACACAATGTCCCAAAACCTGGTCCAGCTGTATTTGTTGCTAATTGCCTCTC...

Protein

Download Protein FASTA

588 aa · TkAUNG044520|TK1151|PROTEIN

MGVDDKTLKLSSDGMTITRQEWPMSLHAYSDLTNVSPVVFLYLLKECYLYGTCKATAKFFSLQHQVLQALHNVPKPGPAVFVANCLSLLPIFESHCEGFSHLMISALRRFLKKGTTNEDLHEAKLLATQLFIISVRGNNIHDDRILVKILEVFNIKLTDIKEVMFQFHLNVKNDKVEDIADVFIEQFISKLLQSQSYLTAVTLLEHLSIRYSGESFLHTMLEKKEYRAAEKWAMFMGKPMILVLINGYVDRKMIKQAYDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG044520`
TK1151 ID	TkAUNG044520
OH-1004 ID	LXL04_001271
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 94.163 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG044520`
Location	ChrUn:12381453-12385538 (-)
Description	Similar to EXD3: Exonuclease mut-7 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001271` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006139 nucleobase-containing compound metabolic process Biological Process GO:0010526 transposable element silencing Biological Process GO:0016441 post-transcriptional gene silencing Biological Process GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing Biological Process GO:0035196 miRNA processing Biological Process GO:0044747 pre-miRNA 3'-end processing Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:1990633 mutator focus Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0000175 3'-5'-RNA exonuclease activity Molecular Function
KEGG gene cross-reference	aag:5579811 ath:AT4G13870 cel:CELE_ZK1098.8 dme:Dmel_CG9247 hsa:54932 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · TkAUNG044520 · TK1151

Nucleus0.459

Rank 2 · TkAUNG044520 · TK1151

Cell membrane0.090

Rank 3 · TkAUNG044520 · TK1151

Mitochondrion0.074

Rank 4 · TkAUNG044520 · TK1151

Endoplasmic reticulum0.067

Rank 5 · TkAUNG044520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01612DNA_pol_A_exo1213-259 aa

PF01612DNA_pol_A_exo1360-533 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG044520	`PF01612`	DNA_pol_A_exo1	213	259	1.1e-22	81.4
TkAUNG044520	`PF01612`	DNA_pol_A_exo1	360	533	1.1e-22	81.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card