TkAUNG042890 | RubberDandelionOmics

Gene overview

TkAUNG042890

Reference: TK1151 Chr: ChrUn Coordinates: 11941592-11942134 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

543 bp · TkAUNG042890|TK1151|cDNA

ATGGCAGCTGCCACCATGTCTCTCAACTCCTGCTCCGTTCAACAGCCGCGAGCCGCCGCCCAAAGACTCCACATGCTTCTCCACTTCACGGCCACCATAGCCATCTTATACTATAGGTTCACCAACCTAATCCACGGTGATGTACCCACCCTGCCATGGGCTCTCATGACAGCTTCCGAGCTTATCTTCTCCTTCATTTGGTTCTTAACGCAACCCTTCCGGTGGCGCCCGGTGGCTCGAACGGTCGCCCTTCAAAATCT...

CDS

Download CDS FASTA

543 bp · TkAUNG042890|TK1151|CDS

ATGGCAGCTGCCACCATGTCTCTCAACTCCTGCTCCGTTCAACAGCCGCGAGCCGCCGCCCAAAGACTCCACATGCTTCTCCACTTCACGGCCACCATAGCCATCTTATACTATAGGTTCACCAACCTAATCCACGGTGATGTACCCACCCTGCCATGGGCTCTCATGACAGCTTCCGAGCTTATCTTCTCCTTCATTTGGTTCTTAACGCAACCCTTCCGGTGGCGCCCGGTGGCTCGAACGGTCGCCCTTCAAAATCT...

Protein

Download Protein FASTA

180 aa · TkAUNG042890|TK1151|PROTEIN

MAAATMSLNSCSVQQPRAAAQRLHMLLHFTATIAILYYRFTNLIHGDVPTLPWALMTASELIFSFIWFLTQPFRWRPVARTVALQNLPDDDQLPKVDVFICTADPSKEPTMEVMNTVLSAMGLDYPSEKLAVYLSDDGGAPSTLYAMKEACFLQRSGCRFVGSMGSRVGPSGVVLLKLWT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG042890`
TK1151 ID	TkAUNG042890
OH-1004 ID	LXL04_003300
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.700
Protein coverage (%)	TK1151 91.667 / OH-1004 23.272 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG042890

Location ChrUn:11941592-11942134 (+)

Description Similar to CSLG1: Cellulose synthase-like protein G1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23990`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`At4g24000`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q651X6`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`Os09g0478100`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003300 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

GO:0016759 cellulose synthase activity Molecular Function

GO:0016760 cellulose synthase (UDP-forming) activity Molecular Function

KEGG gene cross-reference

ath:AT4G23990

ath:AT4G24000

ath:AT4G24010

dosa:Os02g0725300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.395

Rank 1 · TkAUNG042890 · TK1151

Golgi apparatus0.362

Rank 2 · TkAUNG042890 · TK1151

Cell membrane0.148

Rank 3 · TkAUNG042890 · TK1151

Cytoplasm0.121

Rank 4 · TkAUNG042890 · TK1151

Nucleus0.109

Rank 5 · TkAUNG042890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552Cellulose_synt96-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG042890	`PF03552`	Cellulose_synt	96	153	1.6e-14	54.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WVN5`	Arabidopsis thaliana	sp\|Q0WVN5\|CSLG3_ARATH Cellulose synthase-like protein G3	42.300%	Swiss-Prot	Medium
`Q8VYR4`	Arabidopsis thaliana	sp\|Q8VYR4\|CSLG2_ARATH Cellulose synthase-like protein G2	41.700%	Swiss-Prot	Medium
`Q651X6`	Oryza sativa subsp. japonica	sp\|Q651X6\|CSLE6_ORYSJ Cellulose synthase-like protein E6	44.800%	Swiss-Prot	Medium
`Q651X7`	Oryza sativa subsp. japonica	sp\|Q651X7\|CSLE1_ORYSJ Cellulose synthase-like protein E1	43.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card