TkAUNG042050 | RubberDandelionOmics

Gene overview

TkAUNG042050

Reference: TK1151 Chr: ChrUn Coordinates: 11682833-11683834 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · TkAUNG042050|TK1151|cDNA

ATGGCTGGGTTGCTGGGTTGCCGGAGAGGGTGGTTCTTCCTCCTTGTCGGCCACCGCCGAGACCACCATCTAGCCGACGATTTCTTTTCTTCTCCTTCATGGTGCGATAACCTCCAAGCCACAACCGCTATTACATCAAAAGCTGCCATGACTGAACCGGAACCTATTGACTTGGAGTACTACAGAAAAGGACTTAGATCTCACATAGTTGATTCCTACAAAGATTATTATGACAGTGTTGAAATCCCCAAGTTTGTAGA...

CDS

Download CDS FASTA

489 bp · TkAUNG042050|TK1151|CDS

ATGGCTGGGTTGCTGGGTTGCCGGAGAGGGTGGTTCTTCCTCCTTGTCGGCCACCGCCGAGACCACCATCTAGCCGACGATTTCTTTTCTTCTCCTTCATGGTGCGATAACCTCCAAGCCACAACCGCTATTACATCAAAAGCTGCCATGACTGAACCGGAACCTATTGACTTGGAGTACTACAGAAAAGGACTTAGATCTCACATAGTTGATTCCTACAAAGATTATTATGACAGTGTTGAAATCCCCAAGTTTGTAGA...

Protein

Download Protein FASTA

162 aa · TkAUNG042050|TK1151|PROTEIN

MAGLLGCRRGWFFLLVGHRRDHHLADDFFSSPSWCDNLQATTAITSKAAMTEPEPIDLEYYRKGLRSHIVDSYKDYYDSVEIPKFVDKTTPEYKPKFDALMVELKEAEQKSLKESERLEKEIADVQDLKKKLSTMTADEYFEKHPELKKKFDDEIRNDYWGT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG042050`
TK1151 ID	TkAUNG042050
OH-1004 ID	LXL04_003135
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG042050

Location ChrUn:11682833-11683834 (+)

Description Similar to At3g52300: ATP synthase subunit d, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52300`	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003135 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0045259 proton-transporting ATP synthase complex Cellular Component

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT3G52300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.920

Rank 1 · TkAUNG042050 · TK1151

Cytoplasm0.090

Rank 2 · TkAUNG042050 · TK1151

Nucleus0.066

Rank 3 · TkAUNG042050 · TK1151

Cell membrane0.020

Rank 4 · TkAUNG042050 · TK1151

Plastid0.015

Rank 5 · TkAUNG042050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05873Mt_ATP-synt_D51-160 aa

PF28547CHD_PDZ-protease84-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG042050	`PF05873`	Mt_ATP-synt_D	51	160	7.6e-12	46.0
TkAUNG042050	`PF28547`	CHD_PDZ-protease	84	159	0.69	10.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FT52`	Arabidopsis thaliana	sp\|Q9FT52\|ATP5H_ARATH ATP synthase subunit d, mitochondrial	77.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card