TkAUNG035520 | RubberDandelionOmics

Gene overview

TkAUNG035520

Reference: TK1151 Chr: ChrUn Coordinates: 9743996-9747735 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2017 bp · TkAUNG035520|TK1151|cDNA

ATCAAATCGGAGCCGCAAACCAACTCCTCCGTGGCGCCATTTGGTCCTCTCCTAAAGTAACTTTCTTCATTTTCTCTTCTTCTTCAGAAAAAGAAAACGAATACTTCCATAACACTGTGCTACTTCAATAATCTCTTCAAATTTCCTAGTTCACGTCTAAAAAATGGCGAAACTGTATACATTTAGAACAGACACCAGTTTATCTTGTCTTTCACAGCACAAATTTCGCCATCCCTCGAATAAACGGTTCTTAAAACCAT...

CDS

Download CDS FASTA

1575 bp · TkAUNG035520|TK1151|CDS

ATGGCGAAACTGTATACATTTAGAACAGACACCAGTTTATCTTGTCTTTCACAGCACAAATTTCGCCATCCCTCGAATAAACGGTTCTTAAAACCATCATCATCACCATGTTTACTAAACTCAGGGTCTTTAAAAGTTTCTTGTAGCATCAGGGAGAAAGAAAACATCGCAGAAAATGAGAGAATTACTCCGATAGTTACTGGGCTAAGAGTTGATGATGAAATCGGGGAGAAAGCTGGAGATGGGATCGAGAAATTAGG...

Protein

Download Protein FASTA

524 aa · TkAUNG035520|TK1151|PROTEIN

MAKLYTFRTDTSLSCLSQHKFRHPSNKRFLKPSSSPCLLNSGSLKVSCSIREKENIAENERITPIVTGLRVDDEIGEKAGDGIEKLGLENLNWPPWKNVPQRYKLIGTTSLAFVICNMDKVNLSIAIIPMSHQFGWSSSVAGLVQSSFFWGYALSQLPGGWLSKIFGGRIVLQFGVLAWSLATALVPVVAGFMPGLVFTRILVGIGEGVSPSAATDLIARLIPLEERSRAVSFVFGGLSVGSVLGLLLAPPLIESFGWES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG035520`
TK1151 ID	TkAUNG035520
OH-1004 ID	LXL04_002749
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG035520

Location ChrUn:9743996-9747735 (-)

Description Similar to ANTR6: Probable anion transporter 6, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20380`	Inorganic phosphate and probable anion transporter.	No verified direct reference in this release
`At4g00370`	Inorganic phosphate and probable anion transporter.	AtPHT4;4 is a chloroplast-localized ascorbate transporter in Arabidopsis.2015 · DOI: 10.1038/ncomms6928

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0556400`	Probable anion transporter.	No verified direct reference in this release
`Os09g0570400`	Probable anion transporter.	No verified direct reference in this release
`Os01g0279700`	Probable anion transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002749 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0006952 defense response Biological Process

GO:0010028 xanthophyll cycle Biological Process

GO:0015882 L-ascorbic acid transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0005315 phosphate transmembrane transporter activity Molecular Function

GO:0015229 L-ascorbic acid transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G00370

ath:AT5G20380

dosa:Os01g0279700

dosa:Os09g0556400

dosa:Os09g0570400

osa:4326905

osa:4347913

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.960

Rank 1 · TkAUNG035520 · TK1151

Peroxisome0.030

Rank 2 · TkAUNG035520 · TK1151

Mitochondrion0.029

Rank 3 · TkAUNG035520 · TK1151

Golgi apparatus0.026

Rank 4 · TkAUNG035520 · TK1151

Endoplasmic reticulum0.025

Rank 5 · TkAUNG035520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690MFS_1110-476 aa

PF00083Sugar_tr137-524 aa

PF03092BT1198-487 aa

PF24664Monjiviricetes_fusion457-509 aa

PF07690MFS_1474-517 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG035520	`PF07690`	MFS_1	110	476	1.2e-51	176.4
TkAUNG035520	`PF00083`	Sugar_tr	137	524	3.2e-05	23.7
TkAUNG035520	`PF03092`	BT1	198	487	0.00046	19.7
TkAUNG035520	`PF24664`	Monjiviricetes_fusion	457	509	0.41	9.2
TkAUNG035520	`PF07690`	MFS_1	474	517	1.2e-51	176.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E9A0`	Arabidopsis thaliana	sp\|Q3E9A0\|ANTR6_ARATH Probable anion transporter 6, chloroplastic	74.700%	Swiss-Prot	High
`Q8GX78`	Arabidopsis thaliana	sp\|Q8GX78\|ANTR2_ARATH Ascorbate transporter, chloroplastic	40.600%	Swiss-Prot	Medium
`Q0IZQ3`	Oryza sativa subsp. japonica	sp\|Q0IZQ3\|PHT45_ORYSJ Probable anion transporter 5, chloroplastic	74.100%	Swiss-Prot	Medium
`Q652N5`	Oryza sativa subsp. japonica	sp\|Q652N5\|PHT44_ORYSJ Probable anion transporter 4, chloroplastic	41.800%	Swiss-Prot	Medium
`Q9SDI4`	Oryza sativa subsp. japonica	sp\|Q9SDI4\|PHT41_ORYSJ Probable anion transporter 1, chloroplastic	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card