TkAUNG027620 | RubberDandelionOmics

Gene overview

TkAUNG027620

Reference: TK1151 Chr: ChrUn Coordinates: 7385963-7389219 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1325 bp · TkAUNG027620|TK1151|cDNA

TTTATATTACATTTTGAAATGATGAAAAGTAGCCTCGTCGACCTCGGTTTAATCCCGGCGGTGTTTCTTCTTGATTAGTAGCTTAGCCTCGTCAATCTTCGATCCTAAGAAACCGACCTACGTCCTCCTTCCTCCATTTTTTCTCTCGTTTCGCTCCCATTTTCATTTGCCAACGTAACGACCAAAGCTGCACTGATATATCTTGACAATTTAGGGCAAATCGTTTTCGCATAATTCGATTTGATCTCTCTGTGTTTCGA...

CDS

Download CDS FASTA

573 bp · TkAUNG027620|TK1151|CDS

ATGGCGGGGAGGTCAGGATCATCGACGATGATCGTCACAAACACACCGGCTAAAGATCTCGCATATACGAACTGCGCGTATTGCTCTCCTTCCGATCTTCGTCAATTTATTGATCCTGGATCCAATCTCGCTCTCGCTCTCGTTGGTGACGTGTTCGTTCTGTCCAAAACTGCTTATGACACCATACAAAGTGGACAACTTGGGCTTAATGCCATCCAAAGACGTCATGCAAGAGTTTCTACAGGAGATTCAGTATCTGT...

Protein

Download Protein FASTA

190 aa · TkAUNG027620|TK1151|PROTEIN

MAGRSGSSTMIVTNTPAKDLAYTNCAYCSPSDLRQFIDPGSNLALALVGDVFVLSKTAYDTIQSGQLGLNAIQRRHARVSTGDSVSVTRFVPPEDFNIALLTLELEFVKKGNKEEQVDAVHLAQHLRKKFINQVMTAGQRVTFEHQGNGYIFTVSQVAVEGQEKAAIERGLLSSDSYIVFEASNSSGIKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG027620`
TK1151 ID	TkAUNG027620
OH-1004 ID	LXL04_037631
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.600
Protein coverage (%)	TK1151 100.000 / OH-1004 24.448 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG027620

Location ChrUn:7385963-7389219 (+)

Description Similar to NSF: Vesicle-fusing ATPase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04910`	Required for vesicle-mediated transport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0519400`	Required for vesicle-mediated transport.	The OsSec18 complex interacts with P0(P1-P2)2 to regulate vacuolar morphology in rice endosperm cell.2015 · DOI: 10.1186/s12870-014-0324-1

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037631 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001921 positive regulation of receptor recycling Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006887 exocytosis Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0006909 phagocytosis Biological Process

GO:0006935 chemotaxis Biological Process

GO:0007030 Golgi organization Biological Process

GO:0009306 protein secretion Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0017157 regulation of exocytosis Biological Process

KEGG gene cross-reference

ath:AT4G04910

ddi:DDB_G0276153

dosa:Os05g0519400

hsa:4905

spo:2542410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.652

Rank 1 · TkAUNG027620 · TK1151

Cytoplasm0.416

Rank 2 · TkAUNG027620 · TK1151

Endoplasmic reticulum0.044

Rank 3 · TkAUNG027620 · TK1151

Extracellular0.035

Rank 4 · TkAUNG027620 · TK1151

Cell membrane0.032

Rank 5 · TkAUNG027620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02359CDC48_N10-89 aa

PF02933CDC48_279-88 aa

PF06162PgaPase_1108-165 aa

PF02933CDC48_2118-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG027620	`PF02359`	CDC48_N	10	89	2.8e-07	31.4
TkAUNG027620	`PF02933`	CDC48_2	79	88	7e-07	29.5
TkAUNG027620	`PF06162`	PgaPase_1	108	165	0.18	12.3
TkAUNG027620	`PF02933`	CDC48_2	118	161	7e-07	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0Y8`	Arabidopsis thaliana	sp\|Q9M0Y8\|NSF_ARATH Vesicle-fusing ATPase	64.800%	Swiss-Prot	High
`Q0DGP6`	Oryza sativa subsp. japonica	sp\|Q0DGP6\|NSF_ORYSJ Vesicle-fusing ATPase	54.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card