Gene Card
Gene overview
cDNA / CDS / Protein Sequences
456 bp · TkAUNG027180|TK1151|cDNA
ATGTGTCGGACCAAAGACTCAGACTCGGACCACGGACTCGGTCCGTGGTCTGTGCGTTTAATAATGTCCGTCGGACTCGGACCACGGACTCGGTCCGACCTTTTGCCTCAAACTCGGTCCGCCCAAAAAAATCGCAGACTGAGAAATAAGCCTCTGATGTTGGACTCGGTCCGTGGTCCGTGGTCCGTGGTCCGTGGTCTAAGTCCGAGTCCGTTGAATAGCAAACAGCCCCTTAGTAACGTTTACAATTTTTTCTCAAT...
456 bp · TkAUNG027180|TK1151|CDS
ATGTGTCGGACCAAAGACTCAGACTCGGACCACGGACTCGGTCCGTGGTCTGTGCGTTTAATAATGTCCGTCGGACTCGGACCACGGACTCGGTCCGACCTTTTGCCTCAAACTCGGTCCGCCCAAAAAAATCGCAGACTGAGAAATAAGCCTCTGATGTTGGACTCGGTCCGTGGTCCGTGGTCCGTGGTCCGTGGTCTAAGTCCGAGTCCGTTGAATAGCAAACAGCCCCTTAGTAACGTTTACAATTTTTTCTCAAT...
Protein
Download Protein FASTA151 aa · TkAUNG027180|TK1151|PROTEIN
MCRTKDSDSDHGLGPWSVRLIMSVGLGPRTRSDLLPQTRSAQKNRRLRNKPLMLDSVRGPWSVVRGLSPSPLNSKQPLSNVYNFFSINLINENRTLTSTISLKHRRRAVSLHLHPGSPMFLSQLISSRLRNSNKVTLSIFYNLTNLINKNK
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG027180 |
|---|---|
| TK1151 ID | TkAUNG027180 |
| OH-1004 ID | LXL04_031910 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 82.100 |
| Protein coverage (%) | TK1151 47.020 / OH-1004 30.325Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG027180 |
|---|---|
| Location | ChrUn:7263852-7264307 (+) |
| Description | Similar to AHA3: ATPase 3, plasma membrane-type |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010119 regulation of stomatal movement Biological Process GO:0051453 regulation of intracellular pH Biological Process GO:0120029 proton export across plasma membrane Biological Process GO:1902600 proton transmembrane transport Biological Process GO:1990069 stomatal opening Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component |
| KEGG gene cross-reference | ath:AT1G80660 ath:AT2G18960 ath:AT3G47950 ath:AT4G30190 ath:AT5G57350 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.