LXL04_031910 | RubberDandelionOmics

Gene overview

LXL04_031910

Reference: OH-1004 Chr: Chr07 Coordinates: 13079911-13085139 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · LXL04_031910|LXL04_031910|OH1004|cDNA

ATGTGTCGGACCAAAGACTcagactcggaccacggactcggtccgtggtctgtgCGTTTGATAATGTCCGtcggactcggaccacggactcggtccgaccttttgcctcggactcggtccgcccaaAAAAATCGCAGACTGAGAAATAAgcctctgatgtcggactcggtccgtggtccgaggcgtttgataggcgagtttgatgtcggactcggtccgtggtccgtggtccgtggtctgagtccgagtccgaATTGGGT...

CDS

Download CDS FASTA

834 bp · LXL04_031910|LXL04_031910|OH1004|CDS

ATGTGTCGGACCAAAGACTCAGACTCGGACCACGGACTCGGTCCGTGGTCTGTGCGTTTGATAATGTCCGTCGGACTCGGACCACGGACTCGGTCCGACCTTTTGCCTCGGACTCGGTCCGCCCAAAAAAATCGCAGACTGAGAAATAAGCCTCTGATGTCGGACTCGGTCCGTGGTCCGAGGCGTTTGATAGGCGAGTTTGATGTCGGACTCGGTCCGTGGTCCGTGGTCCGTGGTCTGAGTCCGAGTCCGAATTGGGT...

Protein

Download Protein FASTA

277 aa · LXL04_031910|LXL04_031910|OH1004|PROTEIN

MCRTKDSDSDHGLGPWSVRLIMSVGLGPRTRSDLLPRTRSAQKNRRLRNKPLMSDSVRGPRRLIGEFDVGLGPWSVVRGLSPSPNWVTFRKDDDKDGGNAMIWKSDFFFFRSGNQMFSTKERGDKASTGDEGAESVLASMDMVFHFHHDDDGSVSFNHRPPWVSPRASVRELKRLENRKGCYACIIIGEIKAVVIATGVHTFFGKAAHLVDSTNQVRMAVEIVVMYPIQKRSYMSGIDNLLVLLIGGIPIDMPTLLSVTV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031910`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031910

Location Chr07:13079911-13085139 (-)

Description Similar to AHA3: ATPase 3, plasma membrane-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57350`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At1g80660`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At4g30190`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	Mechanism of proton transport by plant plasma membrane proton ATPases.2003 · DOI: 10.1007/s10265-003-0111-9 The effect of a genetically reduced plasma membrane protonmotive force on vegetative growth of Arabidopsis.2012 · DOI: 10.1104/pp.111.189167 Abscisic acid suppresses hypocotyl elongation by dephosphorylating plasma membrane H(+)-ATPase in Arabidopsis thaliana.2014 · DOI: 10.1093/pcp/pcu028 The plasma membrane H(+) -ATPase AHA2 contributes to the root architecture in response to different nitrogen supply.2015 · DOI: 10.1111/ppl.12305 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 Direct observation of proton pumping by a eukaryotic P-type ATPase.2016 · DOI: 10.1126/science.aad6429
`At2g18960`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306
`At3g47950`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031910 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0051453 regulation of intracellular pH Biological Process

GO:0120029 proton export across plasma membrane Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:1990069 stomatal opening Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G80660

ath:AT2G18960

ath:AT3G47950

ath:AT4G30190

ath:AT5G57350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.363

Rank 1 · LXL04_031910 · OH-1004

Nucleus0.337

Rank 2 · LXL04_031910 · OH-1004

Cell membrane0.150

Rank 3 · LXL04_031910 · OH-1004

Mitochondrion0.141

Rank 4 · LXL04_031910 · OH-1004

Endoplasmic reticulum0.097

Rank 5 · LXL04_031910 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P20431`	Arabidopsis thaliana	ATPase 3, plasma membrane-type	68.627%	Swiss-Prot	weak database homology
`Q42556`	Arabidopsis thaliana	ATPase 9, plasma membrane-type	67.647%	Swiss-Prot	weak database homology
`P19456`	Arabidopsis thaliana	ATPase 2, plasma membrane-type	67.647%	Swiss-Prot	weak database homology
`P20649`	Arabidopsis thaliana	ATPase 1, plasma membrane-type	68.627%	Swiss-Prot	weak database homology
`Q9SU58`	Arabidopsis thaliana	ATPase 4, plasma membrane-type	67.647%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card