TkAUNG025080 | RubberDandelionOmics

Gene overview

TkAUNG025080

Reference: TK1151 Chr: ChrUn Coordinates: 6713227-6714717 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1125 bp · TkAUNG025080|TK1151|cDNA

GTTTGTGGTGATATATACGAAACTTCTGTCTCACGTCAACCCTTTTTATTCACATACACACACGATCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTGTGTGTGTGTGTGTGTGATAATATGTATTTCTATGTGTATGTATGCGATATTGCGATTGTGGTTCAAACACTATATAATCCCCACATTGGAATGCTTTTATGACACAT...

CDS

Download CDS FASTA

636 bp · TkAUNG025080|TK1151|CDS

ATGACACATTTAAAGCTCCACATCCTAGTTAAATCTTTTAGAACACCCAGAAAGATAATACACGAAAAGATGGGTGACACCAATAATGTGAATCTGCCACCTGGTTTTCGATTCTGTCCTACAGACGAAGAACTTGTGGTCCATTTTCTTCAACGCAAGGCCTCTCTCTTGCCTTTCCACCCCGACATCATCCCCGATCTTGATCTTTATCCTTATGATCCTTGGAACTTAGATGGTAAAGCTATGGTGGAAGGGAAGAA...

Protein

Download Protein FASTA

211 aa · TkAUNG025080|TK1151|PROTEIN

MTHLKLHILVKSFRTPRKIIHEKMGDTNNVNLPPGFRFCPTDEELVVHFLQRKASLLPFHPDIIPDLDLYPYDPWNLDGKAMVEGKKWYYFSRRSQNRVTANGYWESCGGDEQIVSSNGSKRIGLKKYYVFHVGEAPEGIKTNWMLQEFRVSDGSNSSRSRRRDNSKTDWVICCVYEHDYDGDDNDDGMELSCLDEVFLSLDDYDEISYPN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG025080`
TK1151 ID	TkAUNG025080
OH-1004 ID	LXL04_038695
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG025080

Location ChrUn:6713227-6714717 (+)

Description Similar to NAC104: NAC domain-containing protein 104

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64530`	Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death.	XND1, a member of the NAC domain family in Arabidopsis thaliana, negatively regulates lignocellulose synthesis and programmed cell death in xylem.2008 · DOI: 10.1111/j.1365-313x.2007.03350.x Characterization of NAC domain transcription factors implicated in control of vascular cell differentiation in Arabidopsis and Populus.2010 · DOI: 10.1007/s00425-010-1181-2
`At1g61110`	Transcription factor of the NAC family.	A cis regulatory element in the TAPNAC promoter directs tapetal gene expression.2011 · DOI: 10.1007/s11103-010-9713-5
`At1g52880`	May encode a transcription factor involved in the elaboration of shoot apical meristems (SAM) (Probable).	NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060160
`At3g15510`	Transcription factor of the NAC family (Probable).	NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.2008 · DOI: 10.1105/tpc.108.060160

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038695 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0010089 xylem development Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0048367 shoot system development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048731 system development Biological Process

KEGG gene cross-reference

ath:AT1G61110

ath:AT5G64530

sly:101248026

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.846

Rank 1 · TkAUNG025080 · TK1151

Cytoplasm0.200

Rank 2 · TkAUNG025080 · TK1151

Cell membrane0.068

Rank 3 · TkAUNG025080 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkAUNG025080 · TK1151

Plastid0.021

Rank 5 · TkAUNG025080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM33-151 aa

PF02365NAM162-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG025080	`PF02365`	NAM	33	151	7.3e-34	117.6
TkAUNG025080	`PF02365`	NAM	162	172	7.3e-34	117.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWK6`	Arabidopsis thaliana	sp\|Q8GWK6\|NC104_ARATH NAC domain-containing protein 104	57.500%	Swiss-Prot	High
`Q8GY42`	Arabidopsis thaliana	sp\|Q8GY42\|NAC25_ARATH NAC transcription factor 25	42.300%	Swiss-Prot	Medium
`Q9ZNU2`	Arabidopsis thaliana	sp\|Q9ZNU2\|NAC18_ARATH NAC domain-containing protein 18	43.300%	Swiss-Prot	Medium
`Q9LD44`	Arabidopsis thaliana	sp\|Q9LD44\|NAC56_ARATH NAC transcription factor 56	38.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card