TkAUNG022900 | RubberDandelionOmics

Gene overview

TkAUNG022900

Reference: TK1151 Chr: ChrUn Coordinates: 6135500-6136000 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

459 bp · TkAUNG022900|TK1151|cDNA

ATGGAACAAGATCGTAAATCAGAGCCATGCCCATCTGAAGCTTCAAGCATATCGGCAGAAGGAGATTGCTTGAAGCACAAGAAATTGGATAGGAGGATTGTTAATCAATCATCTTCTCGGCCGCCTTTTCTTGATCTCAAACTGTCAACTACAGAAGACAAGAAAACAGAGCTCAATCTCTTTAACCCTTCAAGGGCGGTGGAAGGCGTCGCAACTTCATCTCAGGCCAGCGAGTCTCCGGACGACGACAATCGAGAAAA...

CDS

Download CDS FASTA

459 bp · TkAUNG022900|TK1151|CDS

ATGGAACAAGATCGTAAATCAGAGCCATGCCCATCTGAAGCTTCAAGCATATCGGCAGAAGGAGATTGCTTGAAGCACAAGAAATTGGATAGGAGGATTGTTAATCAATCATCTTCTCGGCCGCCTTTTCTTGATCTCAAACTGTCAACTACAGAAGACAAGAAAACAGAGCTCAATCTCTTTAACCCTTCAAGGGCGGTGGAAGGCGTCGCAACTTCATCTCAGGCCAGCGAGTCTCCGGACGACGACAATCGAGAAAA...

Protein

Download Protein FASTA

152 aa · TkAUNG022900|TK1151|PROTEIN

MEQDRKSEPCPSEASSISAEGDCLKHKKLDRRIVNQSSSRPPFLDLKLSTTEDKKTELNLFNPSRAVEGVATSSQASESPDDDNREKSRVFSCNYCKREFSTSQALGGHQNAHKQERQIAKRRQMEVPPYGHLCRHHLIIMVTLHTTLRSLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG022900`
TK1151 ID	TkAUNG022900
OH-1004 ID	LXL04_026373
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.500
Protein coverage (%)	TK1151 87.500 / OH-1004 48.837 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG022900

Location ChrUn:6135500-6136000 (-)

Description Similar to ZFP6: Zinc finger protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24625`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At1g80730`	May play a role in the regulation of shoot development, downstream of photomorphogenic activation (Probable).	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294 Expression analysis of an Arabidopsis C2H2 zinc finger protein gene.1996 · DOI: 10.1007/bf00020477
`At5g25160`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At1g67030`	Probable transcription factor required for the initiation of inflorescence trichomes in response to gibberellin and cytokinin.	Zinc Finger Protein 6 (ZFP6) regulates trichome initiation by integrating gibberellin and cytokinin signaling in Arabidopsis thaliana.2013 · DOI: 10.1111/nph.12211 The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At5g57520`	Transcription factor involved in the regulation of floral organ abscission and required for seed and silique development.	Stamen abscission zone transcriptome profiling reveals new candidates for abscission control: enhanced retention of floral organs in transgenic plants overexpressing Arabidopsis ZINC FINGER PROTEIN2.2008 · DOI: 10.1104/pp.107.110908 ZINC FINGER PROTEIN2 suppresses funiculus lignification to ensure seed loading efficiency in Arabidopsis.2025 · DOI: 10.1016/j.devcel.2025.01.021

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026373 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010026 trichome differentiation Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0060860 regulation of floral organ abscission Biological Process

KEGG gene cross-reference

ath:AT1G24625

ath:AT1G66140

ath:AT1G67030

ath:AT1G80730

ath:AT5G57520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.930

Rank 1 · TkAUNG022900 · TK1151

Cytoplasm0.131

Rank 2 · TkAUNG022900 · TK1151

Cell membrane0.039

Rank 3 · TkAUNG022900 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkAUNG022900 · TK1151

Mitochondrion0.012

Rank 5 · TkAUNG022900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18868zf-C2H2_3rep46-113 aa

PF13912zf-C2H2_690-116 aa

PF13894zf-C2H2_491-113 aa

PF00096zf-C2H291-113 aa

PF12171zf-C2H2_jaz91-111 aa

PF13912zf-C2H2_6131-137 aa

PF00096zf-C2H2131-137 aa

PF13894zf-C2H2_4132-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG022900	`PF18868`	zf-C2H2_3rep	46	113	0.069	14.5
TkAUNG022900	`PF13912`	zf-C2H2_6	90	116	7.5e-07	29.7
TkAUNG022900	`PF13894`	zf-C2H2_4	91	113	0.0005	21.3
TkAUNG022900	`PF00096`	zf-C2H2	91	113	0.0045	18.1
TkAUNG022900	`PF12171`	zf-C2H2_jaz	91	111	0.053	14.4
TkAUNG022900	`PF13912`	zf-C2H2_6	131	137	7.5e-07	29.7
TkAUNG022900	`PF00096`	zf-C2H2	131	137	0.0045	18.1
TkAUNG022900	`PF13894`	zf-C2H2_4	132	136	0.0005	21.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39266`	Arabidopsis thaliana	sp\|Q39266\|ZFP7_ARATH Zinc finger protein 7	63.300%	Swiss-Prot	Low
`Q42485`	Arabidopsis thaliana	sp\|Q42485\|ZFP1_ARATH Zinc finger protein 1	46.800%	Swiss-Prot	Medium
`Q39262`	Arabidopsis thaliana	sp\|Q39262\|ZFP3_ARATH Zinc finger protein 3	38.200%	Swiss-Prot	Medium
`Q39265`	Arabidopsis thaliana	sp\|Q39265\|ZFP6_ARATH Zinc finger protein 6	51.400%	Swiss-Prot	Low
`Q39261`	Arabidopsis thaliana	sp\|Q39261\|ZFP2_ARATH Zinc finger protein 2	73.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card