TkAUNG019990 | RubberDandelionOmics

Gene overview

TkAUNG019990

Reference: TK1151 Chr: ChrUn Coordinates: 5350752-5356039 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2718 bp · TkAUNG019990|TK1151|cDNA

GTATAGAGGGGTATTTATTGGGGTTAACAAAGCTCTGATTAACTTCACGTGTAAACTCATCCATGTGTCCGTGAGTCTTTACAAACAACTACTTCGAGAAACACACACACACACACAGAGGAAGTCAGATCAGATCCATTGTATAATCTCTCTGATACAGCTCAAGAACCAGTTCCCATGGTGGATTTTGATTCTTGCTTGGTTTCTTCTACTGTTTTTGTGTTCTTGAAGATGAAAAGATGCGGACTTTTTCGGTCAAA...

CDS

Download CDS FASTA

1962 bp · TkAUNG019990|TK1151|CDS

ATGAGGCGACATGGGGGTGTTTTCTTTGTTTTTTTGGTTTTTTTGTGCTTTGAATGTGCTGTAAGTGATGATAGAGAAGCACTTTTGGGGTTAAAATCTTCAATTGATCCATTGAATTATCTTCAATGGAATGGAAGCGATTTCTGCAAATGGGAAGGAGTGAGAGAATGCTTGAGAGGCAGAGTGTCGAAACTTGTTCTTGAGAATCTGAATTTGACAGGCACATTGGATTCAGGAAGTCTTAATAAGTTGGATCAGAT...

Protein

Download Protein FASTA

653 aa · TkAUNG019990|TK1151|PROTEIN

MRRHGGVFFVFLVFLCFECAVSDDREALLGLKSSIDPLNYLQWNGSDFCKWEGVRECLRGRVSKLVLENLNLTGTLDSGSLNKLDQIRVLSLKQNSISGEIPELSGLANLKSLYLSYNNFSGEFPASITNLHRLKIIVLSGNRLSGPIPDTLLNVQRLYVLYLDDNRFTGKIPPLNQSGLRFLNLSDNELSGEIPATPVLVRFNSTSFSGNVDLCGDAFGITCSVAPSPSLSPANPAPTRHRRRKIRNIIIIAGSVGGFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG019990`
TK1151 ID	TkAUNG019990
OH-1004 ID	LXL04_022429
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.300
Protein coverage (%)	TK1151 100.000 / OH-1004 95.402 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG019990

Location ChrUn:5350752-5356039 (+)

Description Similar to At1g60630: Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60630`	Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630.	No verified direct reference in this release
`At5g67200`	Probable inactive receptor kinase At5g67200.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release
`At5g58300`	Probable inactive receptor kinase At5g58300.	No verified direct reference in this release
`At1g68400`	Probable leucine-rich repeat receptor-like protein kinase At1g68400.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022429 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

GO:0016328 lateral plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60630

ath:AT1G68400

ath:AT2G26730

ath:AT5G58300

ath:AT5G67200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.892

Rank 1 · TkAUNG019990 · TK1151

Endoplasmic reticulum0.076

Rank 2 · TkAUNG019990 · TK1151

Cytoplasm0.072

Rank 3 · TkAUNG019990 · TK1151

Nucleus0.052

Rank 4 · TkAUNG019990 · TK1151

Golgi apparatus0.019

Rank 5 · TkAUNG019990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_222-54 aa

PF25019LRR_R13L1-DRL2125-115 aa

PF24141LRR_ComC60-78 aa

PF13855LRR_862-120 aa

PF12799LRR_465-104 aa

PF00560LRR_167-76 aa

PF23598LRR_1467-163 aa

PF00560LRR_187-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG019990	`PF08263`	LRRNT_2	22	54	3.9e-07	31.0
TkAUNG019990	`PF25019`	LRR_R13L1-DRL21	25	115	0.016	15.8
TkAUNG019990	`PF24141`	LRR_ComC	60	78	0.23	11.8
TkAUNG019990	`PF13855`	LRR_8	62	120	7.5e-10	39.1
TkAUNG019990	`PF12799`	LRR_4	65	104	6.1e-10	39.7
TkAUNG019990	`PF00560`	LRR_1	67	76	3.4e-14	50.6
TkAUNG019990	`PF23598`	LRR_14	67	163	7.9e-06	25.6
TkAUNG019990	`PF00560`	LRR_1	87	103	3.4e-14	50.6
TkAUNG019990	`PF12799`	LRR_4	87	122	6.1e-10	39.7
TkAUNG019990	`PF13516`	LRR_6	88	100	0.015	16.0
TkAUNG019990	`PF24141`	LRR_ComC	98	196	0.23	11.8
TkAUNG019990	`PF13516`	LRR_6	108	123	0.015	16.0
TkAUNG019990	`PF00560`	LRR_1	109	131	3.4e-14	50.6
TkAUNG019990	`PF12799`	LRR_4	109	146	6.1e-10	39.7
TkAUNG019990	`PF13855`	LRR_8	109	168	7.5e-10	39.1
TkAUNG019990	`PF07723`	LRR_2	109	123	0.042	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84MA9`	Arabidopsis thaliana	sp\|Q84MA9\|Y1063_ARATH Inactive leucine-rich repeat receptor-like serine/threonine-protein kinase At1g60630	61.400%	Swiss-Prot	High
`Q93Y06`	Arabidopsis thaliana	sp\|Q93Y06\|Y5720_ARATH Probable inactive receptor kinase At5g67200	45.400%	Swiss-Prot	Medium
`O48788`	Arabidopsis thaliana	sp\|O48788\|Y2267_ARATH Probable inactive receptor kinase At2g26730	44.900%	Swiss-Prot	Medium
`Q9LVM0`	Arabidopsis thaliana	sp\|Q9LVM0\|Y5830_ARATH Probable inactive receptor kinase At5g58300	40.900%	Swiss-Prot	Medium
`Q9M9C5`	Arabidopsis thaliana	sp\|Q9M9C5\|Y1680_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g68400	40.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card