TkAUNG018680 | RubberDandelionOmics

Gene overview

TkAUNG018680

Reference: TK1151 Chr: ChrUn Coordinates: 4955390-4959980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1120 bp · TkAUNG018680|TK1151|cDNA

CTAAAAAGAAAATATCTTCATGTTGAATATTCTCATTCACTAGATTTGAGATTATCCCTATATATCTGCCCAAAAAAACCATACATTTTCATTTAAAACCAAGACATGGCGGCTTTCCCAATATTCCGGTTGCCGGAGGTGTTTAATCCGGCCATAACCACTCATCACGGCCACAGATTCAATCACCAAAAACTCCTTGTCTCAAGCAGATGTATGCGAAGTCCTGCTAAAAAAACAAGAAATGGTCAGAATCATTACGA...

CDS

Download CDS FASTA

888 bp · TkAUNG018680|TK1151|CDS

ATGGCGGCTTTCCCAATATTCCGGTTGCCGGAGGTGTTTAATCCGGCCATAACCACTCATCACGGCCACAGATTCAATCACCAAAAACTCCTTGTCTCAAGCAGATGTATGCGAAGTCCTGCTAAAAAAACAAGAAATGGTCAGAATCATTACGAGTTGCTTGGCGTATCTGTGGACTCCAATTCTAAAGAAATAAAAGAATCCTACAGAAAACTGCAAAAGAAATACCATCCAGATATTGCAGGCCAAAAGGGTCATGA...

Protein

Download Protein FASTA

295 aa · TkAUNG018680|TK1151|PROTEIN

MAAFPIFRLPEVFNPAITTHHGHRFNHQKLLVSSRCMRSPAKKTRNGQNHYELLGVSVDSNSKEIKESYRKLQKKYHPDIAGQKGHEHTILLNEAYNVLMKDNLRKDYDASIGHVRVGFGGDALDMGHSSWNGPFRRHALFVDEKACIGCRECVHNARNTFIMDEILGCARVNVQFGDDDTSIEVAVESCPMDCIHWVEKEELAILEYFNIPRPKQGHGVFNQGWERPQNVFMAAKTFQKQQQQAQSESQSQHKTVRCDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG018680`
TK1151 ID	TkAUNG018680
OH-1004 ID	LXL04_023960
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	97.000
Protein coverage (%)	TK1151 89.492 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG018680

Location ChrUn:4955390-4959980 (+)

Description Similar to DJC76: Chaperone protein dnaJ C76, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23240`	May function together with HSC70 chaperone to assist protein folding and prevent protein aggregation during salt stress in the chloroplast (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023960 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0009408 response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0031072 heat shock protein binding Molecular Function

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G23240

sab:SAB1451c

sam:MW1531

sax:USA300HOU_1580

sca:SCA_1201

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.751

Rank 1 · TkAUNG018680 · TK1151

Mitochondrion0.197

Rank 2 · TkAUNG018680 · TK1151

Nucleus0.052

Rank 3 · TkAUNG018680 · TK1151

Cytoplasm0.028

Rank 4 · TkAUNG018680 · TK1151

Cell membrane0.010

Rank 5 · TkAUNG018680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12797Fer4_233-37 aa

PF00226DnaJ49-109 aa

PF07701HNOBA51-75 aa

PF30912TIM141_C52-101 aa

PF12838Fer4_7138-155 aa

PF12797Fer4_2140-154 aa

PF13459Fer4_15141-197 aa

PF14697Fer4_21141-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG018680	`PF12797`	Fer4_2	33	37	0.028	15.1
TkAUNG018680	`PF00226`	DnaJ	49	109	2.1e-16	60.5
TkAUNG018680	`PF07701`	HNOBA	51	75	0.19	11.9
TkAUNG018680	`PF30912`	TIM141_C	52	101	0.003	18.2
TkAUNG018680	`PF12838`	Fer4_7	138	155	0.027	15.6
TkAUNG018680	`PF12797`	Fer4_2	140	154	0.028	15.1
TkAUNG018680	`PF13459`	Fer4_15	141	197	5.9e-05	24.4
TkAUNG018680	`PF14697`	Fer4_21	141	196	0.0019	19.0
TkAUNG018680	`PF13237`	Fer4_10	141	190	9.4	7.0
TkAUNG018680	`PF13370`	Fer4_13	142	197	2.5e-10	41.6
TkAUNG018680	`PF00037`	Fer4	142	154	0.031	14.8
TkAUNG018680	`PF12837`	Fer4_6	142	154	0.082	13.6
TkAUNG018680	`PF13187`	Fer4_9	145	155	0.062	14.1
TkAUNG018680	`PF12838`	Fer4_7	187	202	0.027	15.6
TkAUNG018680	`PF12797`	Fer4_2	187	191	0.028	15.1
TkAUNG018680	`PF00037`	Fer4	187	195	0.031	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMX6`	Arabidopsis thaliana	sp\|Q9FMX6\|DJC76_ARATH Chaperone protein dnaJ C76, chloroplastic	41.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card