TkAUNG009540 | RubberDandelionOmics

Gene overview

TkAUNG009540

Reference: TK1151 Chr: ChrUn Coordinates: 2384770-2386737 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1968 bp · TkAUNG009540|TK1151|cDNA

ATGAAAGAGGCGATCAGAATGGTACTCGAATCCATTTACGATCCCGAGTTTCCAGACACATCGCACTTCCGCTCGGGTCGAGGCTGCCACTCGGTCCTAAGACGGATCAAAGAAGAGTGGGGAACCTCTCGCTGGTTTTTGGAATTCGACATCAGGAAGTCTTTTCACACCATCGACCGACATCGACTCATCTCAATCTTTAAGGAAGAGATCGACGATCCCAAGTTCTTTTACTCCATTCAAAAAGTCTTTTCCGCCGG...

CDS

Download CDS FASTA

1968 bp · TkAUNG009540|TK1151|CDS

ATGAAAGAGGCGATCAGAATGGTACTCGAATCCATTTACGATCCCGAGTTTCCAGACACATCGCACTTCCGCTCGGGTCGAGGCTGCCACTCGGTCCTAAGACGGATCAAAGAAGAGTGGGGAACCTCTCGCTGGTTTTTGGAATTCGACATCAGGAAGTCTTTTCACACCATCGACCGACATCGACTCATCTCAATCTTTAAGGAAGAGATCGACGATCCCAAGTTCTTTTACTCCATTCAAAAAGTCTTTTCCGCCGG...

Protein

Download Protein FASTA

655 aa · TkAUNG009540|TK1151|PROTEIN

MKEAIRMVLESIYDPEFPDTSHFRSGRGCHSVLRRIKEEWGTSRWFLEFDIRKSFHTIDRHRLISIFKEEIDDPKFFYSIQKVFSAGRLVGGEKGPYSVPHSVLLSALPGNIYLHKLDQDIGRIRQKYEIPIVQRIRSVLLRTGRIDDQENSGEEASFNAPQDNRAIIVGRVKSIQHRCSFHSLVSSWHTPPTSTPRLMGDQKRPFVFPPSSALAAFLNKPSSLLCAAFLIEAAGLTPKAEFYGRERCNNNWAMRDFFKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG009540`
TK1151 ID	TkAUNG009540
OH-1004 ID	LXL04_028653
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.100
Protein coverage (%)	TK1151 37.710 / OH-1004 90.146 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG009540

Location ChrUn:2384770-2386737 (-)

Description Similar to ltrA: Group II intron-encoded protein LtrA (Lactococcus lactis subsp. cremoris (strain MG1363)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04050`	Nuclear-encoded maturase required for splicing of group-II introns in mitochondria.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028653 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006314 intron homing Biological Process

GO:0006315 homing of group II introns Biological Process

GO:0006397 mRNA processing Biological Process

GO:0090615 mitochondrial mRNA processing Biological Process

GO:0000262 mitochondrial chromosome Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

llm:llmg_1371

ppt:PPS_0381

spo:90134240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.518

Rank 1 · TkAUNG009540 · TK1151

Plastid0.306

Rank 2 · TkAUNG009540 · TK1151

Cytoplasm0.119

Rank 3 · TkAUNG009540 · TK1151

Nucleus0.087

Rank 4 · TkAUNG009540 · TK1151

Cell membrane0.029

Rank 5 · TkAUNG009540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_17-69 aa

PF00078RVT_1289-358 aa

PF01348Intron_maturas2517-615 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG009540	`PF00078`	RVT_1	7	69	2.4e-08	34.8
TkAUNG009540	`PF00078`	RVT_1	289	358	2.4e-08	34.8
TkAUNG009540	`PF01348`	Intron_maturas2	517	615	2.3e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZA5`	Arabidopsis thaliana	sp\|Q9LZA5\|NMAT3_ARATH Nuclear intron maturase 3, mitochondrial	31.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card