Gene Card
Gene overview
cDNA / CDS / Protein Sequences
825 bp · LXL04_028653|LXL04_028653|OH1004|cDNA
ATGAAAGAGGCGATCAGAATGGTACTCGAATCCATTTACGATCCCGAGTTTCCAGACACATCGCACTTCCGCTCGGGTCAAGGCTGCCACTCGGCCCTAAGACGGATCAAAGAAGAGTGGGGAACCTCTCGCTGGTTTTTGGAATTCGACATCAGGAAGTGTTTTCACATCATCGACCGACATCGACTCATCCCCATCTTTAAGGAAGAGATCGGCGACCCCAAGTTCTTTTACCCCATTCAGAAAGTCTTTTCTGCCGG...
825 bp · LXL04_028653|LXL04_028653|OH1004|CDS
ATGAAAGAGGCGATCAGAATGGTACTCGAATCCATTTACGATCCCGAGTTTCCAGACACATCGCACTTCCGCTCGGGTCAAGGCTGCCACTCGGCCCTAAGACGGATCAAAGAAGAGTGGGGAACCTCTCGCTGGTTTTTGGAATTCGACATCAGGAAGTGTTTTCACATCATCGACCGACATCGACTCATCCCCATCTTTAAGGAAGAGATCGGCGACCCCAAGTTCTTTTACCCCATTCAGAAAGTCTTTTCTGCCGG...
Protein
Download Protein FASTA274 aa · LXL04_028653|LXL04_028653|OH1004|PROTEIN
MKEAIRMVLESIYDPEFPDTSHFRSGQGCHSALRRIKEEWGTSRWFLEFDIRKCFHIIDRHRLIPIFKEEIGDPKFFYPIQKVFSAGRLVGAEKGPYSVPHSVLLSALPDNIYLHKLDQEIGRIQQKYEILIVQRIRSVLLRTGCIDDQEDSGEEASFKPTQDNRAIIVGRVKSIQRKAAFHSLVSSWHTSPTSTPRLRGDQKRSFVFPPSSALAAFLNKPSSLLCAAFRIEAAELTPKAEFYGGERLLQKKGPADRAGR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_028653 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_028653 |
|---|---|
| Location | Chr06:52272537-52273396 (-) |
| Description | Similar to ltrA: Group II intron-encoded protein LtrA (Lactococcus lactis subsp. cremoris (strain MG1363) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006314 intron homing Biological Process GO:0006315 homing of group II introns Biological Process GO:0006397 mRNA processing Biological Process GO:0090615 mitochondrial mRNA processing Biological Process GO:0000262 mitochondrial chromosome Cellular Component GO:0005739 mitochondrion Cellular Component GO:0003677 DNA binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function |
| KEGG gene cross-reference | llm:llmg_1371 ppt:PPS_0381 spo:90134240 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.