TkAUNG005080 | RubberDandelionOmics

Gene overview

TkAUNG005080

Reference: TK1151 Chr: ChrUn Coordinates: 1521220-1524168 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2880 bp · TkAUNG005080|TK1151|cDNA

ATGTCCACAATACCTGGATTTAATCAGATACAATTTGAAGGATTTTGTAGGTTCATTGATCAGGGTTTGACAGAAGAACTTTCTAAGTTTCCAAAAATTGAAGATACAAATCAAGAAATTGACTTTGAATTATTTTTGGAAAGATATCAATTGGTAGAACCCCCAATAAAGGAAAGAGATGCTGTGTATGAATCACTCACATATTCTTCTGAATTATATGTATCCGCGAGACTTATTTGGAAAAACGATAGGCGTAGGTA...

CDS

Download CDS FASTA

2880 bp · TkAUNG005080|TK1151|CDS

ATGTCCACAATACCTGGATTTAATCAGATACAATTTGAAGGATTTTGTAGGTTCATTGATCAGGGTTTGACAGAAGAACTTTCTAAGTTTCCAAAAATTGAAGATACAAATCAAGAAATTGACTTTGAATTATTTTTGGAAAGATATCAATTGGTAGAACCCCCAATAAAGGAAAGAGATGCTGTGTATGAATCACTCACATATTCTTCTGAATTATATGTATCCGCGAGACTTATTTGGAAAAACGATAGGCGTAGGTA...

Protein

Download Protein FASTA

959 aa · TkAUNG005080|TK1151|PROTEIN

MSTIPGFNQIQFEGFCRFIDQGLTEELSKFPKIEDTNQEIDFELFLERYQLVEPPIKERDAVYESLTYSSELYVSARLIWKNDRRRYIQEQTILIGKIPLMTSLGAFIVNGIYRIVINQILQSPGIYYQSELNDNGISVYTGTIISDWGGRLELEIDRKTRIWVRVSRQQKLSILVLLSAMGLNIREILENVCYPELFLSFLNDKKQIGSKENAILEFYQQFACVEGDPVFSESLSKDLQKKFFQQRCELGGIGRRNMNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG005080`
TK1151 ID	TkAUNG005080
OH-1004 ID	LXL04_022234
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 14.494 / OH-1004 14.479 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG005080`
Location	ChrUn:1521220-1524168 (-)
Description	Similar to FER: Receptor-like protein kinase FERONIA
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022234` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009723 response to ethylene Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process GO:0009791 post-embryonic development Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0010038 response to metal ion Biological Process GO:0010118 stomatal movement Biological Process GO:0010483 pollen tube reception Biological Process GO:0030308 negative regulation of cell growth Biological Process GO:0032922 circadian regulation of gene expression Biological Process
KEGG gene cross-reference	ath:AT3G51550 ath:AT5G38990 ath:AT5G39000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.285

Rank 1 · TkAUNG005080 · TK1151

Mitochondrion0.262

Rank 2 · TkAUNG005080 · TK1151

Plastid0.255

Rank 3 · TkAUNG005080 · TK1151

Cytoplasm0.054

Rank 4 · TkAUNG005080 · TK1151

Cell membrane0.015

Rank 5 · TkAUNG005080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04563RNA_pol_Rpb2_19-354 aa

PF04561RNA_pol_Rpb2_2122-307 aa

PF04565RNA_pol_Rpb2_3368-436 aa

PF10385RNA_pol_Rpb2_45456-507 aa

PF00562RNA_pol_Rpb2_6520-551 aa

PF00562RNA_pol_Rpb2_6573-942 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG005080	`PF04563`	RNA_pol_Rpb2_1	9	354	4.9e-11	43.3
TkAUNG005080	`PF04561`	RNA_pol_Rpb2_2	122	307	9.2e-54	182.7
TkAUNG005080	`PF04565`	RNA_pol_Rpb2_3	368	436	1.2e-24	86.9
TkAUNG005080	`PF10385`	RNA_pol_Rpb2_45	456	507	0.0045	17.7
TkAUNG005080	`PF00562`	RNA_pol_Rpb2_6	520	551	1.2e-94	318.3
TkAUNG005080	`PF00562`	RNA_pol_Rpb2_6	573	942	1.2e-94	318.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card