TkAUNG004240 | RubberDandelionOmics

Gene overview

TkAUNG004240

Reference: TK1151 Chr: ChrUn Coordinates: 1279286-1279606 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

321 bp · TkAUNG004240|TK1151|cDNA

ATGCCGAACATGTCGATGAATCTTCCATGGGCGGGTTCCTGTGAAGAAGACGCACTCAAAATGCAGTTACAGTGGCCTTCTCGGCTTTCGTTTGTTGGGGAAGCCATTCTTAATGAACGGGAGGTGAGGACTTACGAGAGTGCGAGTGCTTTATCGCTGGCCAATTTCACATCTTCGTTGTTTGAATTTGTTGCGAGGCTTCAGAATCTGCTCAATTCGTTTAAAGAGCTTAGCGAAAAGGCAAAATTCACAGACACGAA...

CDS

Download CDS FASTA

321 bp · TkAUNG004240|TK1151|CDS

ATGCCGAACATGTCGATGAATCTTCCATGGGCGGGTTCCTGTGAAGAAGACGCACTCAAAATGCAGTTACAGTGGCCTTCTCGGCTTTCGTTTGTTGGGGAAGCCATTCTTAATGAACGGGAGGTGAGGACTTACGAGAGTGCGAGTGCTTTATCGCTGGCCAATTTCACATCTTCGTTGTTTGAATTTGTTGCGAGGCTTCAGAATCTGCTCAATTCGTTTAAAGAGCTTAGCGAAAAGGCAAAATTCACAGACACGAA...

Protein

Download Protein FASTA

106 aa · TkAUNG004240|TK1151|PROTEIN

MPNMSMNLPWAGSCEEDALKMQLQWPSRLSFVGEAILNEREVRTYESASALSLANFTSSLFEFVARLQNLLNSFKELSEKAKFTDTKNPLEKEEGGFWTRLMGFNN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG004240`
TK1151 ID	TkAUNG004240
OH-1004 ID	LXL04_005812
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 45.106 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG004240

Location ChrUn:1279286-1279606 (+)

Description Similar to ALMT6: Aluminum-activated malate transporter 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17470`	Malate transporter.	No verified direct reference in this release
`At1g68600`	Malate transporter.	No verified direct reference in this release
`At1g25480`	Malate transporter.	No verified direct reference in this release
`At3g18440`	Vacuolar malate channel.	The Arabidopsis vacuolar malate channel is a member of the ALMT family.2007 · DOI: 10.1111/j.1365-313x.2007.03367.x
`At1g18420`	Malate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005812 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009625 response to insect Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0015743 malate transport Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0048367 shoot system development Biological Process

GO:0071423 malate transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT1G02730

ath:AT1G25480

ath:AT1G68600

ath:AT2G17470

ath:AT3G18440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.348

Rank 1 · TkAUNG004240 · TK1151

Nucleus0.298

Rank 2 · TkAUNG004240 · TK1151

Mitochondrion0.233

Rank 3 · TkAUNG004240 · TK1151

Cell membrane0.101

Rank 4 · TkAUNG004240 · TK1151

Plastid0.084

Rank 5 · TkAUNG004240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11744ALMT15-78 aa

PF26387DUF6079_5th15-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG004240	`PF11744`	ALMT	15	78	3.4e-10	40.2
TkAUNG004240	`PF26387`	DUF6079_5th	15	88	0.024	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHM1`	Arabidopsis thaliana	sp\|Q9SHM1\|ALMT6_ARATH Aluminum-activated malate transporter 6	50.000%	Swiss-Prot	High
`Q93Z29`	Arabidopsis thaliana	sp\|Q93Z29\|ALMT5_ARATH Aluminum-activated malate transporter 5	52.500%	Swiss-Prot	High
`Q9C6L8`	Arabidopsis thaliana	sp\|Q9C6L8\|ALMT4_ARATH Aluminum-activated malate transporter 4	53.400%	Swiss-Prot	Medium
`Q9LS46`	Arabidopsis thaliana	sp\|Q9LS46\|ALMT9_ARATH Aluminum-activated malate transporter 9	53.500%	Swiss-Prot	Medium
`Q9LPQ8`	Arabidopsis thaliana	sp\|Q9LPQ8\|ALMT3_ARATH Putative aluminum-activated malate transporter 3	50.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card