LXL04_005812 | RubberDandelionOmics

Gene overview

LXL04_005812

Reference: OH-1004 Chr: Chr01 Coordinates: 173821772-173822676 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

708 bp · LXL04_005812|LXL04_005812|OH1004|cDNA

ATGGATTCAATTGCTGTGGCTGAATTTGGGGGTAGATTGATTCATGAGTTACGTGGAAAAGGCAGCCATGGAAGACCTTCAGGATCCCTCGCTGTTCAACGCGAGCCAATTGATCGAGCAGCCATTGAAGAAGCAATTAAGGTCGTGACTTGTTTCTATGAAGATAAAACCGAATGGGCTACCGGCCCCGATTTTGACCTACTCGAGAAGGTACACGAAGCCGCAGAGGAATTACAAATGTTGATAGATGAGAAATCGTA...

CDS

Download CDS FASTA

708 bp · LXL04_005812|LXL04_005812|OH1004|CDS

ATGGATTCAATTGCTGTGGCTGAATTTGGGGGTAGATTGATTCATGAGTTACGTGGAAAAGGCAGCCATGGAAGACCTTCAGGATCCCTCGCTGTTCAACGCGAGCCAATTGATCGAGCAGCCATTGAAGAAGCAATTAAGGTCGTGACTTGTTTCTATGAAGATAAAACCGAATGGGCTACCGGCCCCGATTTTGACCTACTCGAGAAGGTACACGAAGCCGCAGAGGAATTACAAATGTTGATAGATGAGAAATCGTA...

Protein

Download Protein FASTA

235 aa · LXL04_005812|LXL04_005812|OH1004|PROTEIN

MDSIAVAEFGGRLIHELRGKGSHGRPSGSLAVQREPIDRAAIEEAIKVVTCFYEDKTEWATGPDFDLLEKVHEAAEELQMLIDEKSYHLVSATAKQKHMDDAAHEEEEEHSNETPRLKQSHTFKNIDRHMPNMSMNLPWAGSCEEDALKMQLQWPSRLSFVGEAILNEREVRTYESASALSLANFTSSLFEFVARLQNLLNSFKELSEKAKFTDTKNPLEKEEGGFWTRLMGFNN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005812`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005812

Location Chr01:173821772-173822676 (-)

Description Similar to ALMT6: Aluminum-activated malate transporter 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17470`	Malate transporter.	No verified direct reference in this release
`At1g68600`	Malate transporter.	No verified direct reference in this release
`At1g25480`	Malate transporter.	No verified direct reference in this release
`At1g02730`	Involved in stem and root growth.	Disruption of ATCSLD5 results in reduced growth, reduced xylan and homogalacturonan synthase activity and altered xylan occurrence in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03281.x
`At3g18440`	Vacuolar malate channel.	The Arabidopsis vacuolar malate channel is a member of the ALMT family.2007 · DOI: 10.1111/j.1365-313x.2007.03367.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005812 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009625 response to insect Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0015743 malate transport Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0048367 shoot system development Biological Process

GO:0071423 malate transmembrane transport Biological Process

KEGG gene cross-reference

ath:AT1G02730

ath:AT1G25480

ath:AT1G68600

ath:AT2G17470

ath:AT3G18440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.361

Rank 1 · LXL04_005812 · OH-1004

Cytoplasm0.350

Rank 2 · LXL04_005812 · OH-1004

Cell membrane0.297

Rank 3 · LXL04_005812 · OH-1004

Endoplasmic reticulum0.088

Rank 4 · LXL04_005812 · OH-1004

Mitochondrion0.083

Rank 5 · LXL04_005812 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11744.15ALMT33-207 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005812	`PF11744.15`	ALMT	33	207	4.4e-21	76.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHM1`	Arabidopsis thaliana	Aluminum-activated malate transporter 6	41.573%	Swiss-Prot	moderate database homology
`Q93Z29`	Arabidopsis thaliana	Aluminum-activated malate transporter 5	39.877%	Swiss-Prot	moderate database homology
`Q9C6L8`	Arabidopsis thaliana	Aluminum-activated malate transporter 4	37.500%	Swiss-Prot	moderate database homology
`Q9SRW9`	Arabidopsis thaliana	Cellulose synthase-like protein D5	65.517%	Swiss-Prot	weak database homology
`Q9LS46`	Arabidopsis thaliana	Aluminum-activated malate transporter 9	36.098%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card