TkAUNG002760 | RubberDandelionOmics

Gene overview

TkAUNG002760

Reference: TK1151 Chr: ChrUn Coordinates: 878978-882027 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2677 bp · TkAUNG002760|TK1151|cDNA

GTCCAATTCCGACCTTTCACCTAAGAAAAACCGGCCCTTATATTTTTGGATTTATTAAAGCAACCTTTTTCTCATCTTTCAAAACCCATCAAAGAAAAATCATTTCTTGATATGGGTTCTCTCATATTCGATCCGATTTAGTGTGAACAACCCCCAGAAACTACACACAGGGACGATGGAGAAGGTATACGTGGCAATCGGGAATGACGTACAAGAAGGTTTTGCTACTCTCGAATGGACGCTAAGAAAATGGTCTTCTT...

CDS

Download CDS FASTA

2337 bp · TkAUNG002760|TK1151|CDS

ATGGAGAAGGTATACGTGGCAATCGGGAATGACGTACAAGAAGGTTTTGCTACTCTCGAATGGACGCTAAGAAAATGGTCTTCTTCTCCAATCTCCATTGTTATCCTTCATGCAGATATAAACAGGGACTATGTTTACACATATTATGGAAAACTCCCTGCGAGTTATGTGAACGATGAGAGTGTCGACTTACTTAATAAGTATCAACAAGGAAAACTGAACAAGATTCTACAGCAGTACATAGATTTTTGTGGCGAGGT...

Protein

Download Protein FASTA

778 aa · TkAUNG002760|TK1151|PROTEIN

MEKVYVAIGNDVQEGFATLEWTLRKWSSSPISIVILHADINRDYVYTYYGKLPASYVNDESVDLLNKYQQGKLNKILQQYIDFCGEVKTETLNIEKYDEPIHTRILQLISGLRICKLVMGATFFKSFSSGKFGNLVMGLKKLQQKKPDFCEFYLISGGKLFFLKEENNEGFIEDDQGMTIAKLNKKRGSFKGWIGKMYPKNTRDSSSSSSSSADSPSIWERSTEEIEQYFNQLLNSNEDEEESETGQASNAIFENNEFTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG002760`
TK1151 ID	TkAUNG002760
OH-1004 ID	LXL04_014012
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG002760

Location ChrUn:878978-882027 (-)

Description Similar to PUB50: Putative U-box domain-containing protein 50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65500`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At2g45910`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At3g49060`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At2g19410`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At1g66880`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0163000`	Functions as an E3 ubiquitin ligase.	MODD Mediates Deactivation and Degradation of OsbZIP46 to Negatively Regulate ABA Signaling and Drought Resistance in Rice.2016 · DOI: 10.1105/tpc.16.00171

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014012 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G19410

ath:AT2G45910

ath:AT5G61550

ath:AT5G65500

dosa:Os06g0163000

osa:4340220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.486

Rank 1 · TkAUNG002760 · TK1151

Nucleus0.328

Rank 2 · TkAUNG002760 · TK1151

Cell membrane0.324

Rank 3 · TkAUNG002760 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkAUNG002760 · TK1151

Golgi apparatus0.042

Rank 5 · TkAUNG002760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07160SKA154-73 aa

PF25190Tad557-86 aa

PF12795MscS_porin210-242 aa

PF07160SKA1278-404 aa

PF02601Exonuc_VII_L288-391 aa

PF30810AFAP_C288-349 aa

PF12795MscS_porin291-404 aa

PF13990YjcZ295-360 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG002760	`PF07160`	SKA1	54	73	0.0074	16.8
TkAUNG002760	`PF25190`	Tad5	57	86	0.65	10.9
TkAUNG002760	`PF12795`	MscS_porin	210	242	3.4	7.9
TkAUNG002760	`PF07160`	SKA1	278	404	0.0074	16.8
TkAUNG002760	`PF02601`	Exonuc_VII_L	288	391	3.7	7.6
TkAUNG002760	`PF30810`	AFAP_C	288	349	4.9	8.2
TkAUNG002760	`PF12795`	MscS_porin	291	404	3.4	7.9
TkAUNG002760	`PF13990`	YjcZ	295	360	0.28	11.3
TkAUNG002760	`PF16331`	TolA_bind_tri	312	373	1.5	9.7
TkAUNG002760	`PF22913`	NBAS_11th	314	353	0.26	11.9
TkAUNG002760	`PF07889`	DUF1664	331	400	2.1	9.1
TkAUNG002760	`PF30810`	AFAP_C	345	379	4.9	8.2
TkAUNG002760	`PF13990`	YjcZ	355	413	0.28	11.3
TkAUNG002760	`PF04799`	Fzo_mitofusin	358	416	7.0	6.8
TkAUNG002760	`PF22913`	NBAS_11th	362	434	0.26	11.9
TkAUNG002760	`PF25190`	Tad5	372	422	0.65	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGD7`	Arabidopsis thaliana	sp\|Q9FGD7\|PUB50_ARATH Putative U-box domain-containing protein 50	41.700%	Swiss-Prot	Medium
`Q8GUH1`	Arabidopsis thaliana	sp\|Q8GUH1\|PUB33_ARATH U-box domain-containing protein 33	26.900%	Swiss-Prot	Low
`Q94A51`	Arabidopsis thaliana	sp\|Q94A51\|PUB32_ARATH U-box domain-containing protein 32	26.600%	Swiss-Prot	Low
`Q8S8S7`	Arabidopsis thaliana	sp\|Q8S8S7\|PUB34_ARATH U-box domain-containing protein 34	33.800%	Swiss-Prot	Low
`F4HQ17`	Arabidopsis thaliana	sp\|F4HQ17\|LRL14_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4	36.400%	Swiss-Prot	Low
`Q5WA76`	Oryza sativa subsp. japonica	sp\|Q5WA76\|PUB70_ORYSJ U-box domain-containing protein 70	34.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card