Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1128 bp · TkAUNG001060|TK1151|cDNA
ATGTCAAGTCCCGTAAAGCAAAAAGAATATAGACGCCCTGATGGGCGTAAGAGGATAATACCAGAAGCAGTTGGAGTAACTGCCCATCAGGAAAGAACCTCAATTGGTGCTCAGTCTGAAGGCCCCAAGTTACCAGTGAAATCCTTAGATCATAATAAGGATGCTAATGGTGCTATACATACTGATAATGGTACAAGAGAGGGATCTATAAGGAAAGTTGCAAGTGCGAGTGCTGATTTGAAAGAGCGTTCCGGTGTCAC...
1128 bp · TkAUNG001060|TK1151|CDS
ATGTCAAGTCCCGTAAAGCAAAAAGAATATAGACGCCCTGATGGGCGTAAGAGGATAATACCAGAAGCAGTTGGAGTAACTGCCCATCAGGAAAGAACCTCAATTGGTGCTCAGTCTGAAGGCCCCAAGTTACCAGTGAAATCCTTAGATCATAATAAGGATGCTAATGGTGCTATACATACTGATAATGGTACAAGAGAGGGATCTATAAGGAAAGTTGCAAGTGCGAGTGCTGATTTGAAAGAGCGTTCCGGTGTCAC...
Protein
Download Protein FASTA375 aa · TkAUNG001060|TK1151|PROTEIN
MSSPVKQKEYRRPDGRKRIIPEAVGVTAHQERTSIGAQSEGPKLPVKSLDHNKDANGAIHTDNGTREGSIRKVASASADLKERSGVTARASISESLVIEKVSSRGSKETSNNVEQIGFLASGSILSIQMFDKKQGEDAIPVCLDARPKEHAVNDIVGAGNTYMINETEVSCTRGSQILWSDRISGKVTVLSGNSNFWAVGCEDGSLQIYTRCGRRALPTMMMGSAAVFIDCDEFWKLLLVTRKGSLYVWDLFNKKCLLED...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG001060 |
|---|---|
| TK1151 ID | TkAUNG001060 |
| OH-1004 ID | LXL04_004676 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 65.000 |
| Protein coverage (%) | TK1151 95.467 / OH-1004 34.714Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG001060 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:270135-272309 (-) | ||||||||||||
| Description | Similar to Os09g0567700: Protein HIRA | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006334 nucleosome assembly Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0034728 nucleosome organization Biological Process GO:0045814 negative regulation of gene expression, epigenetic Biological Process GO:0000417 HIR complex Cellular Component GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0030875 rDNA protrusion Cellular Component GO:0031491 nucleosome binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT3G44530 cnb:CNBH2820 dosa:Os09g0567700 yli:2911845 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23726Beta-prop_RSE1_2nd94-211 aaPF23385Beta-prop_IFT140_2nd176-210 aaPF07569Hira213-351 aaPF23385Beta-prop_IFT140_2nd226-309 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG001060 | PF23726 | Beta-prop_RSE1_2nd | 94 | 211 | 0.11 | 12.5 |
| TkAUNG001060 | PF23385 | Beta-prop_IFT140_2nd | 176 | 210 | 0.19 | 11.5 |
| TkAUNG001060 | PF07569 | Hira | 213 | 351 | 1.7e-34 | 120.1 |
| TkAUNG001060 | PF23385 | Beta-prop_IFT140_2nd | 226 | 309 | 0.19 | 11.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.