TkA08G434390 | RubberDandelionOmics

Gene overview

TkA08G434390

Reference: TK1151 Chr: Chr08 Coordinates: 110400074-110402050 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

628 bp · TkA08G434390|TK1151|cDNA

CAGGTGTTCACGCGTGTAGAGTAATATATCTCATACACCCACCATTATTCCTGAGGCTGCTCCTCAAACACATTCCGCATTATTTGTCAAATTTTCGAGAGCGAAAATAAAGTTTTCAATGGCGACATCGAAACTACAGGCTCTCTGGAACCACCCTGCTGGCCCCAAAACTATTCATTTTTGGGCTCCGACATTCAAGTGGGGAATCAGCATTGCTAATATTGCAGATTTCGCCAAGCCACCAGAGAAACTTTCGTACC...

CDS

Download CDS FASTA

336 bp · TkA08G434390|TK1151|CDS

ATGGCGACATCGAAACTACAGGCTCTCTGGAACCACCCTGCTGGCCCCAAAACTATTCATTTTTGGGCTCCGACATTCAAGTGGGGAATCAGCATTGCTAATATTGCAGATTTCGCCAAGCCACCAGAGAAACTTTCGTACCCACAACAATTTGCTGTCACAGCCACTGGAATTATCTGGTCTCGCTACAGCATGGTAATCACCCCGAAAAACTGGAATCTTTTTAGTGTAAATGTTGCGATGGCTGGAACAGGATTTTA...

Protein

Download Protein FASTA

111 aa · TkA08G434390|TK1151|PROTEIN

MATSKLQALWNHPAGPKTIHFWAPTFKWGISIANIADFAKPPEKLSYPQQFAVTATGIIWSRYSMVITPKNWNLFSVNVAMAGTGFYQLSRKIRHDYFNEEETATATAIKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G434390`
TK1151 ID	TkA08G434390
OH-1004 ID	LXL04_026415
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	64.000
Protein coverage (%)	TK1151 77.477 / OH-1004 13.551 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G434390

Location Chr08:110400074-110402050 (-)

Description Similar to MPC4: Mitochondrial pyruvate carrier 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22310`	Mediates the uptake of pyruvate into mitochondria.	No verified direct reference in this release
`At4g05590`	Mediates the uptake of pyruvate into mitochondria.	NRGA1, a putative mitochondrial pyruvate carrier, mediates ABA regulation of guard cell ion channels and drought stress responses in Arabidopsis.2014 · DOI: 10.1093/mp/ssu061
`At4g14695`	Mediates the uptake of pyruvate into mitochondria.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026415 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0006850 pyruvate import into mitochondria Biological Process

GO:0009932 cell tip growth Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT4G05590

ath:AT4G12420

ath:AT4G14695

ath:AT4G22310

mmu:70456

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.959

Rank 1 · TkA08G434390 · TK1151

Nucleus0.035

Rank 2 · TkA08G434390 · TK1151

Cytoplasm0.033

Rank 3 · TkA08G434390 · TK1151

Cell membrane0.028

Rank 4 · TkA08G434390 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkA08G434390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03650MPC3-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G434390	`PF03650`	MPC	3	106	1.1e-38	132.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49636`	Arabidopsis thaliana	sp\|O49636\|MPC4_ARATH Mitochondrial pyruvate carrier 4	86.900%	Swiss-Prot	High
`Q8LD38`	Arabidopsis thaliana	sp\|Q8LD38\|MPC3_ARATH Mitochondrial pyruvate carrier 3	78.300%	Swiss-Prot	High
`Q8L7H8`	Arabidopsis thaliana	sp\|Q8L7H8\|MPC2_ARATH Mitochondrial pyruvate carrier 2	80.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card