TkA08G433240 | RubberDandelionOmics

Gene overview

TkA08G433240

Reference: TK1151 Chr: Chr08 Coordinates: 110126235-110129049 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2056 bp · TkA08G433240|TK1151|cDNA

TTTTCAACTGAACTCCCTATAGCTCTCACTTCCATTCAAAACGTGAATCAATTATTTTCTCCTCCCTCTTGAAATCCCTAATTCGGTGACATTTCCTCCATCTCCCTGATCACATAACCCCATCGTTGGACCAACTCCTCCATCTGGAACACCACCGCTGCTTGCACCGCTATAAGTCGACCGGTCACGAGCTGCATCATTCATCATTGTTGTTGCTTCCACCATCACCACCATTCGTATTTGTCATTATGCCATTCACG...

CDS

Download CDS FASTA

621 bp · TkA08G433240|TK1151|CDS

ATGGTTGATATATGGGACAATAAAGGTGAGCAAGCGGCAAGAAAGGTCTCTAAGCTTATTTTGATCCCTGTTGTTGAAGTAGAGCCACCTGGATGCTCATACCATCCAACCTCTGAAAGTCATCAGGATTCATTAGCACATGCAGTTGCAGATGAAATGCAGAAGATTTACACAAAAGAACTACGGCCTACACCTGTTCCTTTAACTGTCCCTGGAGAAGTCATTGATGAGGAAGACATTTTTTTCCTTGATGCGGACAA...

Protein

Download Protein FASTA

206 aa · TkA08G433240|TK1151|PROTEIN

MVDIWDNKGEQAARKVSKLILIPVVEVEPPGCSYHPTSESHQDSLAHAVADEMQKIYTKELRPTPVPLTVPGEVIDEEDIFFLDADKENDDDDDVDENDDADLEKRPFKTKRVTRVVLNKRIRNKEKMKVQAEAKKTKEFAKELDSLPAIINKITKEDEEKSKSHERRVIAKQERLKSCPPCLGRHKFEPTPVQVLLSEDITGSYL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G433240`
TK1151 ID	TkA08G433240
OH-1004 ID	LXL04_012179
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 99.029 / OH-1004 58.543 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G433240

Location Chr08:110126235-110129049 (-)

Description Similar to At2g40430: Ribosome biogenesis protein NOP53

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40430`	May play a role in ribosome biogenesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012179 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0000460 maturation of 5.8S rRNA Biological Process

GO:0001932 regulation of protein phosphorylation Biological Process

GO:0006281 DNA repair Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process

GO:0031333 negative regulation of protein-containing complex assembly Biological Process

GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

KEGG gene cross-reference

ath:AT2G40430

cel:CELE_Y39B6A.33

mmu:68077

spo:2541680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.655

Rank 1 · TkA08G433240 · TK1151

Cytoplasm0.335

Rank 2 · TkA08G433240 · TK1151

Mitochondrion0.053

Rank 3 · TkA08G433240 · TK1151

Cell membrane0.043

Rank 4 · TkA08G433240 · TK1151

Endoplasmic reticulum0.025

Rank 5 · TkA08G433240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07767Nop5317-204 aa

PF13060DUF392147-56 aa

PF27116YjiV_N75-188 aa

PF08158SDA1_HEAT81-139 aa

PF05764YL183-168 aa

PF05327RRN385-164 aa

PF13060DUF3921138-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G433240	`PF07767`	Nop53	17	204	1.6e-24	87.8
TkA08G433240	`PF13060`	DUF3921	47	56	0.31	11.8
TkA08G433240	`PF27116`	YjiV_N	75	188	0.025	16.0
TkA08G433240	`PF08158`	SDA1_HEAT	81	139	0.35	10.5
TkA08G433240	`PF05764`	YL1	83	168	0.03	15.1
TkA08G433240	`PF05327`	RRN3	85	164	3.5	6.8
TkA08G433240	`PF13060`	DUF3921	138	165	0.31	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22892`	Arabidopsis thaliana	sp\|O22892\|NOP53_ARATH Ribosome biogenesis protein NOP53	38.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card