TkA08G409270 | RubberDandelionOmics

Gene overview

TkA08G409270

Reference: TK1151 Chr: Chr08 Coordinates: 104165064-104169068 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1622 bp · TkA08G409270|TK1151|cDNA

TGTATCGATAAATATATGTTTGTACGAATCACTCCCGTTCGTTCATTTTCTTTCTACCTGATATTTTTAGACATTCAACTTGAATTCTCAGAGAAAATTGAGAGAGAGAGATGAGCAGCACACAGTCGCTACACTCGCTAGCCTTCAGGGTAATGCGGCTATGTCGGCCGACGTTCCACATCGAAACCCCGCTCCGATTCGACCTTTCCGATCTCATCGTTGGTGAGGATCTCTTGGACGATCCATCCGCCGCACCTCAC...

CDS

Download CDS FASTA

1311 bp · TkA08G409270|TK1151|CDS

ATGAGCAGCACACAGTCGCTACACTCGCTAGCCTTCAGGGTAATGCGGCTATGTCGGCCGACGTTCCACATCGAAACCCCGCTCCGATTCGACCTTTCCGATCTCATCGTTGGTGAGGATCTCTTGGACGATCCATCCGCCGCACCTCACCTTCGTCGTCTCCTTCAATCTCAATCCACGACAACTGACTCCTCCACCGATCTCACCTACAGTAATCGGTTCCTCCTCCGTGATGACCCCTCTGACGCCATGGGCCTTCC...

Protein

Download Protein FASTA

436 aa · TkA08G409270|TK1151|PROTEIN

MSSTQSLHSLAFRVMRLCRPTFHIETPLRFDLSDLIVGEDLLDDPSAAPHLRRLLQSQSTTTDSSTDLTYSNRFLLRDDPSDAMGLPGMLVLPQAFGAIYLGETFCSYISINNSSSFEVRDIIIKAEIQTERQRILLLDTTKTPVETIRAGGRYDFFVEHDVKELGAHTLVCTAQYSDGDAERKYLPQYFKFMVSNPLSVRTKVRVVKETTYLEACLENNTKSNLFMDQVEFEPTPQWVATLLNPDHHHSEDGVLTREVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G409270`
TK1151 ID	TkA08G409270
OH-1004 ID	LXL04_034245
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 95.085 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G409270`
Location	Chr08:104165064-104169068 (-)
Description	Similar to trappc13: Trafficking protein particle complex subunit 13
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034245` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006901 vesicle coating Biological Process GO:0099022 vesicle tethering Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:1990072 TRAPPIII protein complex Cellular Component
KEGG gene cross-reference	bta:511108 dre:321203 hsa:80006 pon:100172189 rno:294709 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.491

Rank 1 · TkA08G409270 · TK1151

Golgi apparatus0.347

Rank 2 · TkA08G409270 · TK1151

Nucleus0.175

Rank 3 · TkA08G409270 · TK1151

Endoplasmic reticulum0.148

Rank 4 · TkA08G409270 · TK1151

Lysosome / Vacuole0.136

Rank 5 · TkA08G409270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06159TRAPPC13_N8-194 aa

PF23643TRAPPC13_C99-157 aa

PF23647TRAPPC13_M198-317 aa

PF23643TRAPPC13_C336-424 aa

PF26283Ig_TRAPPC9-Trs120_4th366-409 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G409270	`PF06159`	TRAPPC13_N	8	194	7.8e-37	127.6
TkA08G409270	`PF23643`	TRAPPC13_C	99	157	1.2e-17	64.5
TkA08G409270	`PF23647`	TRAPPC13_M	198	317	4.5e-22	79.6
TkA08G409270	`PF23643`	TRAPPC13_C	336	424	1.2e-17	64.5
TkA08G409270	`PF26283`	Ig_TRAPPC9-Trs120_4th	366	409	0.033	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card