TkA08G390130 | RubberDandelionOmics

Gene overview

TkA08G390130

Reference: TK1151 Chr: Chr08 Coordinates: 99494430-99500166 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1818 bp · TkA08G390130|TK1151|cDNA

ATTGGTTTTACTTTTTAGACCGGCCCACACCAAGATAACCAGATCCAATGAACAAGCCCAGTATTGAATGTAATAGGAAGTAGGCACACTGCTACTGCCAGGAGAGAAGGGGTTGGAGAGAGAGAGAGAGAGACGGCGAGAACGAGAAGGCAACCTGATCCTCCGCGTCTGTTTCTTCATCGGCGCTAACGGAGTTGGGACTAGGACGTTTTGTTTCTCGATTCTTCCTCGTTTTGTCGATCTCCAGATGGTTGCTGTTT...

CDS

Download CDS FASTA

1839 bp · TkA08G390130|TK1151|CDS

ATGGATAAAGCTGATGATTTGACTTTTAGGATTATTTTCTCGGGAGATGGAGCTGGAAGGTTGCGGGACAAAGTGAAGGAAAAGCTCAAGGAGTTTATGGGAGACTACACAGATGACACTCTTGTGGAATATGTGATTGTATTGCTTAAAAACGGAAGGCGCAAAGAAGAAGCAAAGAATGAGTTAAACGTCTTTTTGGGTGATGACAGCGACTCTTTTGTATCATGGTTGTGGGACCACCTGGGATCAAATCTAAATTT...

Protein

Download Protein FASTA

612 aa · TkA08G390130|TK1151|PROTEIN

MDKADDLTFRIIFSGDGAGRLRDKVKEKLKEFMGDYTDDTLVEYVIVLLKNGRRKEEAKNELNVFLGDDSDSFVSWLWDHLGSNLNLYSQAQPQAKDEAVKHKKEDDLETEGTIKSKKRVSKDWRGVMRDPDEQPPPPPLRSAVIANIHPKDDNTPQPLTQRKRGRSTSAERHDDETSQLKVKPKPSLGASRRLLQFAVRDAVATSRSTSGLTLTSEPSFKRLRSVVSTPNEPDRPKIRSVARVPKSMAVAIKAVADAAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G390130`
TK1151 ID	TkA08G390130
OH-1004 ID	LXL04_034460
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.300
Protein coverage (%)	TK1151 100.000 / OH-1004 94.471 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G390130`
Location	Chr08:99494430-99500166 (+)
Description	Similar to PABPN1L: Embryonic polyadenylate-binding protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034460` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000165 MAPK cascade Biological Process GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Biological Process GO:0031124 mRNA 3'-end processing Biological Process GO:0071222 cellular response to lipopolysaccharide Biological Process GO:1904247 positive regulation of polynucleotide adenylyltransferase activity Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0016607 nuclear speck Cellular Component GO:0042405 nuclear inclusion body Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function
KEGG gene cross-reference	ath:AT5G65260 ddi:DDB_G0277371 hsa:390748 xla:398201 xtr:407911 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952

Rank 1 · TkA08G390130 · TK1151

Cytoplasm0.098

Rank 2 · TkA08G390130 · TK1151

Cell membrane0.028

Rank 3 · TkA08G390130 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA08G390130 · TK1151

Plastid0.010

Rank 5 · TkA08G390130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11517Nab220-84 aa

PF01480PWI25-82 aa

PF28441RRM_1127-58 aa

PF16842RRM_occluded431-506 aa

PF14605Nup35_RRM_2432-489 aa

PF00076RRM_1433-501 aa

PF05172RRM_Nup35446-514 aa

PF28441RRM_11459-512 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G390130	`PF11517`	Nab2	20	84	0.00062	20.8
TkA08G390130	`PF01480`	PWI	25	82	4.7e-07	30.8
TkA08G390130	`PF28441`	RRM_11	27	58	0.0041	18.1
TkA08G390130	`PF16842`	RRM_occluded	431	506	0.032	14.8
TkA08G390130	`PF14605`	Nup35_RRM_2	432	489	0.13	12.9
TkA08G390130	`PF00076`	RRM_1	433	501	3.1e-17	62.9
TkA08G390130	`PF05172`	RRM_Nup35	446	514	0.054	14.2
TkA08G390130	`PF28441`	RRM_11	459	512	0.0041	18.1
TkA08G390130	`PF24475`	RBD_DEAH11	474	505	0.072	13.9
TkA08G390130	`PF24475`	RBD_DEAH11	594	608	0.072	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card